Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05478
Secondary Accession Numbers
  • 11077
Name Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
Synonyms
  1. Alpha-1,2-mannosidase IC
  2. HMIC
  3. Mannosidase alpha class 1C member 1
  4. Processing alpha-1,2-mannosidase IC
Gene Name MAN1C1
Protein Type Unknown
Biological Properties
General Function Involved in mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
Specific Function Involved in the maturation of Asn-linked oligosaccharides. Trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce first Man(8)GlcNAc(2) then Man(6)GlcNAc and a small amount of Man(5)GlcNAc.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
  • Protein processing in endoplasmic reticulum
Reactions
+ Water → + D-Mannose details
Water + → D-Mannose + details
GO Classification
Biological Process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
integral to Golgi membrane
Component
membrane
cell part
Function
mannosidase activity
mannosyl-oligosaccharide mannosidase activity
ion binding
mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
calcium ion binding
Molecular Function
mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
calcium ion binding
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 1
Locus 1p35
SNPs MAN1C1
Gene Sequence
>1893 bp
ATGCTCATGAGGAAAGTGCCCGGCTTCGTCCCGGCCTCCCCGTGGGGGCTGCGGCTGCCG
CAGAAGTTCCTCTTCCTCCTCTTCCTCTCGGGCCTGGTCACCCTGTGCTTCGGGGCCCTC
TTCCTGCTGCCCCACTCCTCTCGCCTCAAGCGCCTCTTCCTGGCCCCCCGGACCCAGCAG
CCTGGTCTGGAAGTGGTGGCTGAAATCGCCGGCCATGCCCCGGCCCGCGAGCAGGAGCCG
CCTCCCAACCCGGCCCCCGCCGCGCCGGCCCCGGGCGAGGATGACCCCAGCAGCTGGGCC
AGTCCCCGCCGCAGGAAAGGGGGGCTGCGGCGCACCCGCCCCACTGGACCCCGCGAGGAG
GCCACGGCGGCCCGGGGCAATAGCATCCCGGCCTCCAGGCCCGGGGACGAGGGCGTCCCT
TTCCGCTTTGACTTCAACGCATTCCGGAGCCGTCTCCGCCACCCGGTCCTGGGAACGAGG
GCCGATGAGAGTCAGGAGCCCCAGAGCCAAGTGCGAGCCCAGCGGGAGAAAATCAAGGAG
ATGATGCAGTTTGCTTGGCAGAGCTATAAGCGTTATGCAATGGGGAAAAACGAACTCCGT
CCACTAACAAAAGATGGCTACGAGGGTAACATGTTCGGAGGCCTCAGCGGGGCAACAGTC
ATTGACTCCCTCGATACCCTCTACCTCATGGAGCTGAAGGAGGAGTTCCAGGAGGCCAAG
GCCTGGGTGGGAGAGAGCTTCCACCTGAACGTGAGCGGAGAAGCATCCTTGTTTGAGGTG
AACATCCGCTACATCGGGGGACTCCTCTCAGCCTTCTACCTGACAGGAGAAGAGGTGTTC
CGAATAAAGGCCATCAGGCTGGGAGAGAAGCTCCTGCCGGCGTTCAACACCCCCACGGGA
ATCCCAAAGGGCGTGGTGAGCTTCAAAAGTGGGAACTGGGGCTGGGCCACAGCCGGCAGC
AGCAGCATCTTGGCGGAGTTTGGATCCCTGCACTTGGAATTCTTACACCTCACTGAACTC
TCTGGCAACCAGGTCTTCGCTGAAAAGGTCAGGAACATCCGCAAGGTCCTCAGGAAGATC
GAAAAGCCCTTTGGCCTCTACCCCAACTTCCTCAGCCCAGTGAGTGGGAACTGGGTGCAA
CACCATGTCTCAGTTGGAGGACTCGGGGACAGTTTTTATGAATATTTGATCAAATCCTGG
TTGATGTCGGGCAAGACAGATATGGAGGCTAAAAATATGTACTACGAAGCCTTGGAGGCG
ATAGAGACCTACTTGCTGAATGTCTCTCCCGGGGGGCTGACCTACATTGCCGAGTGGCGA
GGGGGGATTCTGGACCACAAGATGGGGCACCTGGCCTGTTTCTCCGGGGGCATGATCGCC
CTTGGCGCCGAGGATGCCAAGGAAGAAAAGAGGGCCCACTACCGAGAGCTCGCAGCCCAG
ATCACCAAGACGTGTCACGAGTCATACGCCCGCTCAGACACCAAACTTGGGCCTGAGGCC
TTCTGGTTTAACTCCGGCAGAGAGGCCGTGGCCACCCAGCTGAGCGAGAGCTACTACATC
CTCCGGCCAGAGGTGGTGGAGAGCTACATGTACCTGTGGCGACAGACCCACAACCCCATC
TACAGGGAGTGGGGCTGGGAGGTGGTGCTGGCCTTGGAGAAATACTGTCGGACAGAAGCC
GGTTTCTCTGGGATCCAAGACGTGTACAGTAGCACCCCCAACCACGACAACAAGCAGCAG
AGCTTCTTTCTAGCGGAGACACTAAAGTATCTCTATCTTCTGTTCTCTGAAGATGACTTG
CTCTCCCTGGAAGACTGGGTGTTCAACACCGAGGCCCACCCACTCCCGGTGAACCACTCA
GACAGCTCCGGCAGAGCCTGGGGCAGACACTGA
Protein Properties
Number of Residues 630
Molecular Weight 70910.025
Theoretical pI 7.465
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
MLMRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFLAPRTQQ
PGLEVVAEIAGHAPAREQEPPPNPAPAAPAPGEDDPSSWASPRRRKGGLRRTRPTGPREE
ATAARGNSIPASRPGDEGVPFRFDFNAFRSRLRHPVLGTRADESQEPQSQVRAQREKIKE
MMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSGATVIDSLDTLYLMELKEEFQEAK
AWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTG
IPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKI
EKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEA
IETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQ
ITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPI
YREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDL
LSLEDWVFNTEAHPLPVNHSDSSGRAWGRH
GenBank ID Protein 9664312
UniProtKB/Swiss-Prot ID Q9NR34
UniProtKB/Swiss-Prot Entry Name MA1C1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF261655
GeneCard ID MAN1C1
GenAtlas ID MAN1C1
HGNC ID HGNC:19080
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  4. Tremblay LO, Herscovics A: Characterization of a cDNA encoding a novel human Golgi alpha 1, 2-mannosidase (IC) involved in N-glycan biosynthesis. J Biol Chem. 2000 Oct 13;275(41):31655-60. [PubMed:10915796 ]