Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05493
Secondary Accession Numbers
  • 11092
Name Sodium/glucose cotransporter 4
Synonyms
  1. Na(+)/glucose cotransporter 4
  2. Solute carrier family 5 member 9
  3. hSGLT4
Gene Name SLC5A9
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
sodium ion transport
transmembrane transport
Cellular Component
plasma membrane
integral to membrane
Component
membrane
cell part
Function
transporter activity
Molecular Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 1
Locus 1p33
SNPs SLC5A9
Gene Sequence
>2046 bp
ATGAGCAAGGAGCTGGCAGCAATGGGGCCTGGAGCTTCAGGGGACGGGGTCAGGACTGAG
ACAGCTCCACACATAGCACTGGACTCCAGAGTTGGTCTGCACGCCTACGACATCAGCGTG
GTGGTCATCTACTTTGTCTTCGTCATTGCTGTGGGGATCTGGTCGTCCATCCGTGCAAGT
CGAGGGACCATTGGCGGCTATTTCCTGGCCGGGAGGTCCATGAGCTGGTGGCCAATTGGA
GCATCTCTGATGTCCAGCAATGTGGGCAGTGGCTTGTTCATCGGCCTGGCTGGGACAGGG
GCTGCCGGAGGCCTTGCCGTAGGTGGCTTCGAGTGGAACGCAACCTGGCTGCTCCTGGCC
CTTGGCTGGGTCTTCGTCCCTGTGTACATCGCAGCAGGTGTGGTCACAATGCCGCAGTAT
CTGAAGAAGCGATTTGGGGGCCAGAGGATCCAGGTGTACATGTCTGTCCTGTCTCTCATC
CTCTACATCTTCACCAAGATCTCGACTGACATCTTCTCTGGAGCCCTCTTCATCCAGATG
GCATTGGGCTGGAACCTGTACCTCTCCACAGGGATCCTGCTGGTGGTGACTGCCGTCTAC
ACCATTGCAGGTGGCCTCATGGCCGTGATCTACACAGATGCTCTGCAGACGGTGATCATG
GTAGGGGGAGCCCTGGTCCTCATGTTTCTGGGCTTTCAGGACGTGGGCTGGTACCCAGGC
CTGGAGCAGCGGTACAGGCAGGCCATCCCTAATGTCACAGTCCCCAACACCACCTGTCAC
CTCCCACGGCCCGATGCTTTCCACATGCTTCGGGACCCTGTGAGCGGGGACATCCCTTGG
CCAGGTCTCATTTTCGGGCTCACAGTGCTGGCCACCTGGTGTTGGTGCACAGACCAGGTC
ATTGTGCAGCGGTCTCTCTCGGCCAAGAGTCTGTCTCATGCCAAGGGAGGCTCCGTGCTG
GGGGGCTACCTGAAGATCCTCCCCATGTTCTTCATCGTCATGCCTGGCATGATCAGCCGG
GCCCTGTTCCCAGACGAGGTGGGCTGCGTGGACCCTGATGTCTGCCAAAGAATCTGTGGG
GCCCGAGTGGGATGTTCCAACATTGCCTACCCTAAGTTGGTCATGGCCCTCATGCCTGTT
GGTCTGCGGGGGCTGATGATTGCCGTGATCATGGCCGCTCTCATGAGCTCACTCACCTCC
ATCTTCAACAGCAGCAGCACCCTGTTCACCATTGATGTGTGGCAGCGCTTCCGCAGAAAG
TCAACAGAGCAGGAGCTGATGGTGGTGGGCAGAGTGTTTGTGGTGTTCCTGGTTGTCATC
AGCATCCTCTGGATCCCCATCATCCAAAGCTCCAACAGTGGGCAGCTCTTCGACTACATC
CAGGCTGTCACCAGTTACCTGGCCCCACCCATCACCGCTCTCTTCCTGCTGGCCATCTTC
TGCAAGAGGGTCACAGAGCCCGGAGCTTTCTGGGGCCTCGTGTTTGGCCTGGGAGTGGGG
CTTCTGCGTATGATCCTGGAGTTCTCATACCCAGCGCCAGCCTGTGGGGAGGTGGACCGG
AGGCCAGCAGTGCTGAAGGACTTCCACTACCTGTACTTTGCAATCCTCCTCTGCGGGCTC
ACTGCCATCGTCATTGTCATTGTCAGCCTCTGTACAACTCCCATCCCTGAGGAACAGCTC
ACACGCCTCACATGGTGGACTCGGAACTGCCCCCTCTCTGAGCTGGAGAAGGAGGCCCAC
GAGAGCACACCGGAGATATCCGAGAGGCCAGCCGGGGAGTGCCCTGCAGGAGGTGGAGCG
GCAGAGAACTCGAGCCTGGGCCAGGAGCAGCCTGAAGCCCCAAGCAGGTCCTGGGGAAAG
TTGCTCTGGAGCTGGTTCTGTGGGCTCTCTGGAACACCGGAGCAGGCCCTGAGCCCAGCA
GAGAAGGCTGCGCTAGAACAGAAGCTGACAAGCATTGAGGAGGAGCCACTCTGGAGACAT
GTCTGCAACATCAATGCTGTCCTTTTGCTGGCCATCAACATCTTCCTCTGGGGCTATTTT
GCGTGA
Protein Properties
Number of Residues 681
Molecular Weight 74072.31
Theoretical pI 7.093
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium/glucose cotransporter 4
MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIAVGIWSSIRAS
RGTIGGYFLAGRSMSWWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATWLLLA
LGWVFVPVYIAAGVVTMPQYLKKRFGGQRIQVYMSVLSLILYIFTKISTDIFSGALFIQM
ALGWNLYLSTGILLVVTAVYTIAGGLMAVIYTDALQTVIMVGGALVLMFLGFQDVGWYPG
LEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQV
IVQRSLSAKSLSHAKGGSVLGGYLKILPMFFIVMPGMISRALFPDEVGCVDPDVCQRICG
ARVGCSNIAYPKLVMALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFTIDVWQRFRRK
STEQELMVVGRVFVVFLVVISILWIPIIQSSNSGQLFDYIQAVTSYLAPPITALFLLAIF
CKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVLKDFHYLYFAILLCGL
TAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHESTPEISERPAGECPAGGGA
AENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRH
VCNINAVLLLAINIFLWGYFA
GenBank ID Protein 193785962
UniProtKB/Swiss-Prot ID Q2M3M2
UniProtKB/Swiss-Prot Entry Name SC5A9_HUMAN
PDB IDs Not Available
GenBank Gene ID AK131200
GeneCard ID SLC5A9
GenAtlas ID SLC5A9
HGNC ID HGNC:22146
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Tazawa S, Yamato T, Fujikura H, Hiratochi M, Itoh F, Tomae M, Takemura Y, Maruyama H, Sugiyama T, Wakamatsu A, Isogai T, Isaji M: SLC5A9/SGLT4, a new Na+-dependent glucose transporter, is an essential transporter for mannose, 1,5-anhydro-D-glucitol, and fructose. Life Sci. 2005 Jan 14;76(9):1039-50. [PubMed:15607332 ]