Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05675
Secondary Accession Numbers
  • 11274
Name Electrogenic sodium bicarbonate cotransporter 4
Synonyms
  1. NBCe2
  2. Solute carrier family 4 member 5
Gene Name SLC4A5
Protein Type Transporter
Biological Properties
General Function Involved in anion transport
Specific Function Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na(+):HCO3(-) stoichiometry of 2:1. May have a housekeeping function in regulating the pH of tissues in which it is expressed. May play a role in mediating Na(+):HCO3(-) cotransport in hepatocytes and intrahepatic cholangiocytes. Also may be important in protecting the renal paranchyma from alterations in urine pH
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
inorganic anion exchanger activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
anion:anion antiporter activity
transporter activity
anion transmembrane transporter activity
Process
establishment of localization
transport
anion transport
ion transport
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2p13
SNPs SLC4A5
Gene Sequence
>3414 bp
ATGAAGGTGAAGGAGGAGAAGGCTGGGGTAGGAAAGCTGGACCACACTAACCACAGGAGG
AGATTTCCGGATCAGAAAGAATGCCCTCCTATCCACATTGGGCTTCCAGTACCCACTTAC
CCTCAAAGAAAAACTGACCAGAAGGGACATCTTTCAGGCCTGCAAAAAGTCCACTGGGGC
CTGCGGCCAGACCAGCCACAGCAGGAACTGACTGGCCCAGGGAGTGGGGCAAGCAGCCAG
GACAGCAGCATGGATCTTATCAGCAGGACTCGGTCCCCAGCTGCTGAGCAGCTCCAGGAC
ATCCTGGGGGAGGAAGATGAGGCTCCCAACCCCACCCTCTTTACAGAGATGGATACTCTG
CAGCATGACGGAGACCAGATGGAGTGGAAGGAGTCAGCCAGGTGGATAAAGTTTGAAGAA
AAGGTAGAGGAAGGCGGCGAACGCTGGAGCAAGCCCCACGTGTCCACACTATCCCTGCAC
AGCCTCTTCGAGCTCCGTACCTGCCTGCAGACGGGGACGGTGCTGCTGGATTTGGACAGT
GGCTCCTTACCACAGATCATAGATGATGTCATTGAGAAGCAGATTGAGGATGGTCTCCTG
CGGCCAGAGCTCCGGGAGAGGGTCAGTTACGTCCTCCTGAGGAGGCACCGCCACCAAACC
AAGAAGCCCATCCACCGCTCCTTAGCTGACATTGGGAAGTCAGTCTCCACCACAAATCGC
AGTCCTGCCCGGAGCCCTGGTGCTGGCCCGAGTCTACACCACTCCACGGAAGACCTGCGG
ATGCGGCAGAGTGCAAATTACGGACGTCTGTGTCATGCCCAGAGCAGAAGCATGAATGAC
ATTTCTCTCACCCCAAACACAGACCAGCGGAAAAACAAATTCATGAAGAAGATCCCCAAG
GACTCAGAAGCGTCCAACGTGCTCGTGGGCGAGGTGGACTTCCTAGACCAGCCATTCATC
GCGTTCGTGCGCCTCATCCAGTCGGCCATGCTGGGAGGAGTGACCGAGGTGCCTGTCCCC
ACCAGATTTCTGTTTATACTACTGGGACCTTCTGGGAGAGCAAAATCCTACAATGAAATT
GGCCGTGCCATTGCAACCCTCATGGTAGATGATCTCTTCAGTGACGTGGCCTACAAAGCC
CGCAATCGGGAAGATCTGATCGCAGGAATTGATGAATTTCTGGATGAGGTCATCGTCCTT
CCTCCTGGAGAATGGGACCCAAATATCCGGATTGAGCCCCCCAAGAAGGTGCCCTCTGCT
GACAAGAGGAAATCTGTGTTCTCCCTAGCAGAGCTGGGCCAGATGAATGGCTCTGTGGGA
GGAGGCGGCGGAGCTCCTGGAGGAGGCAATGGAGGTGGTGGTGGTGGTGGCAGTGGCGGC
GGGGCTGGCAGTGGCGGGGCCGGCGGAACAAGCAGCGGGGATGATGGAGAGATGCCAGCC
ATGCATGAAATCGGGGAGGAACTTATCTGGACAGGAAGGTTCTTCGGTGGCCTGTGTCTG
GATATCAAGAGGAAGTTGCCCTGGTTCCCAAGTGACTTCTATGATGGCTTCCACATTCAG
TCCATCTCTGCCATCCTATTCATCTACCTCGGCTGTATCACCAACGCGATCACCTTTGGT
GGGCTTCTGGGGGATGCCACCGACAATTATCAGGGAGTGATGGAGAGCTTCCTGGGCACT
GCCATGGCTGGCTCCTTGTTCTGCCTCTTCTCGGGACAGCCTCTCATCATTCTCAGCAGC
ACGGGGCCCATCCTCATCTTTGAGAAGCTCCTCTTCGACTTCAGCAAAGGCAATGGCCTG
GACTACATGGAGTTCCGCCTCTGGATTGGCCTACACTCAGCTGTCCAGTGCCTTATCCTA
GTGGCCACAGATGCCAGCTTTATCATCAAATATATCACCCGCTTCACCGAGGAGGGCTTC
TCCACCCTTATCAGCTTCATCTTCATCTACGATGCCATCAAGAAGATGATCGGTGCCTTC
AAGTACTACCCTATCAATATGGACTTCAAGCCAAACTTCATCACTACCTACAAGTGCGAG
TGTGTCGCCCCTGACACAGTGAATACAACCGTGTTCAATGCTTCAGCCCCATTGGCACCA
GACACCAACGCTTCTCTGTACAACCTCCTTAACCTCACAGCGTTGGACTGGTCCCTGCTG
AGCAAGAAGGAGTGTCTGAGCTACGGCGGGCGCCTGCTTGGGAATTCCTGCAAGTTTATC
CCAGACCTGGCGCTCATGTCCTTCATCCTTTTCTTTGGGACATACTCCATGACCCTGACC
CTGAAGAAGTTCAAATTCAGCCGCTATTTTCCTACCAAGGTCCGGGCCCTGGTGGCTGAC
TTTTCCATTGTTTTCTCCATCCTGATGTTCTGTGGAATCGATGCCTGTTTTGGCCTAGAA
ACTCCCAAGCTGCATGTGCCCAGTGTCATCAAGCCAACGCGGCCTGACCGAGGCTGGTTC
GTGGCCCCCTTTGGGAAGAACCCGTGGTGGGTATACCCAGCAAGCATCCTGCCCGCCCTG
CTGGTGACCATCCTGATCTTCATGGACCAGCAGATCACTGCCGTCATTGTCAACCGGAAG
GAGAACAAACTGAAGAAGGCTGCCGGCTACCATCTGGACCTGTTCTGGGTGGGCATCCTC
ATGGCTTTGTGCTCCTTTATGGGGCTCCCCTGGTACGTGGCTGCCACGGTCATCTCCATC
GCCCACATCGACAGCCTCAAGATGGAGACAGAGACCAGTGCCCCTGGGGAGCAGCCCCAG
TTTCTGGGAGTCAGGGAACAGAGAGTAACCGGCATCATCGTCTTCATCCTGACGGGAATC
TCTGTCTTCCTGGCTCCCATCCTAAAGTGTATCCCCCTGCCGGTGCTGTACGGAGTCTTC
CTCTACATGGGCGTGGCCTCCCTGAATGGCATCCAGATGGGGACCGGAGGGTCAGAATTC
AAAATCCAGAAGAAGCTGACTCCATTCTGGGAACGCTGCAAGCTCTTCCTGATGCCAGCC
AAGCACCAGCCGGACCATGCCTTCCTGCGGCACGTGCCGCTGCGCCGGATCCACCTCTTC
ACCCTGGTGCAGATCCTCTGCCTGGCGGTGCTCTGGATCCTCAAATCCACGGTGGCTGCC
ATCATCTTCCCGGTCATGATCCTGGGCCTCATCATCGTTCGAAGGCTTCTGGATTTCATC
TTTTCCCAGCACGACCTGGCCTGGATTGACAACATCCTCCCAGAGAAGGAAAAAAAGGAG
ACAGACAAGAAGAGGAAGAGAAAAAAAGGGGCCCACGAGGACTGTGATGAGGAGCCCCAG
TTCCCTCCTCCCTCGGTTATAAAGATTCCCATGGAAAGTGTCCAATCAGATCCCCAAAAC
GGTATCCACTGCATTGCCAGAAAAAGATCTTCCAGTTGGAGTTACTCACTCTGA
Protein Properties
Number of Residues 1137
Molecular Weight 126254.0
Theoretical pI 7.98
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 524-544
  • 567-587
  • 609-629
  • 640-660
  • 739-759
  • 777-797
  • 828-848
  • 874-894
  • 931-951
  • 953-973
  • 1012-1032
  • 1033-1053
Protein Sequence
>Electrogenic sodium bicarbonate cotransporter 4
MKVKEEKAGVGKLDHTNHRRRFPDQKECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWG
LRPDQPQQELTGPGSGASSQDSSMDLISRTRSPAAEQLQDILGEEDEAPNPTLFTEMDTL
QHDGDQMEWKESARWIKFEEKVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDS
GSLPQIIDDVIEKQIEDGLLRPELRERVSYVLLRRHRHQTKKPIHRSLADIGKSVSTTNR
SPARSPGAGPSLHHSTEDLRMRQSANYGRLCHAQSRSMNDISLTPNTDQRKNKFMKKIPK
DSEASNVLVGEVDFLDQPFIAFVRLIQSAMLGGVTEVPVPTRFLFILLGPSGRAKSYNEI
GRAIATLMVDDLFSDVAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSA
DKRKSVFSLAELGQMNGSVGGGGGAPGGGNGGGGGGGSGGGAGSGGAGGTSSGDDGEMPA
MHEIGEELIWTGRFFGGLCLDIKRKLPWFPSDFYDGFHIQSISAILFIYLGCITNAITFG
GLLGDATDNYQGVMESFLGTAMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKGNGL
DYMEFRLWIGLHSAVQCLILVATDASFIIKYITRFTEEGFSTLISFIFIYDAIKKMIGAF
KYYPINMDFKPNFITTYKCECVAPDTVNTTVFNASAPLAPDTNASLYNLLNLTALDWSLL
SKKECLSYGGRLLGNSCKFIPDLALMSFILFFGTYSMTLTLKKFKFSRYFPTKVRALVAD
FSIVFSILMFCGIDACFGLETPKLHVPSVIKPTRPDRGWFVAPFGKNPWWVYPASILPAL
LVTILIFMDQQITAVIVNRKENKLKKAAGYHLDLFWVGILMALCSFMGLPWYVAATVISI
AHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVF
LYMGVASLNGIQMGTGGSEFKIQKKLTPFWERCKLFLMPAKHQPDHAFLRHVPLRRIHLF
TLVQILCLAVLWILKSTVAAIIFPVMILGLIIVRRLLDFIFSQHDLAWIDNILPEKEKKE
TDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
GenBank ID Protein 125987596
UniProtKB/Swiss-Prot ID Q9BY07
UniProtKB/Swiss-Prot Entry Name S4A5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_021196.3
GeneCard ID SLC4A5
GenAtlas ID SLC4A5
HGNC ID HGNC:18168
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Damkier HH, Nielsen S, Praetorius J: Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues. Am J Physiol Regul Integr Comp Physiol. 2007 Nov;293(5):R2136-46. Epub 2007 Aug 22. [PubMed:17715183 ]
  3. Pushkin A, Abuladze N, Newman D, Lee I, Xu G, Kurtz I: Cloning, characterization and chromosomal assignment of NBC4, a new member of the sodium bicarbonate cotransporter family. Biochim Biophys Acta. 2000 Sep 7;1493(1-2):215-8. [PubMed:10978526 ]
  4. Pushkin A, Abuladze N, Newman D, Lee I, Xu G, Kurtz I: Two C-terminal variants of NBC4, a new member of the sodium bicarbonate cotransporter family: cloning, characterization, and localization. IUBMB Life. 2000 Jul;50(1):13-9. [PubMed:11087115 ]
  5. Pushkin A, Abuladze N, Newman D, Tatishchev S, Kurtz I: Genomic organization of the DCTN1-SLC4A5 locus encoding both NBC4 and p150(Glued). Cytogenet Cell Genet. 2001;95(3-4):163-8. [PubMed:12063394 ]
  6. Sassani P, Pushkin A, Gross E, Gomer A, Abuladze N, Dukkipati R, Carpenito G, Kurtz I: Functional characterization of NBC4: a new electrogenic sodium-bicarbonate cotransporter. Am J Physiol Cell Physiol. 2002 Feb;282(2):C408-16. [PubMed:11788353 ]
  7. Virkki LV, Wilson DA, Vaughan-Jones RD, Boron WF: Functional characterization of human NBC4 as an electrogenic Na+-HCO cotransporter (NBCe2). Am J Physiol Cell Physiol. 2002 Jun;282(6):C1278-89. [PubMed:11997242 ]
  8. Xu J, Wang Z, Barone S, Petrovic M, Amlal H, Conforti L, Petrovic S, Soleimani M: Expression of the Na+-HCO-3 cotransporter NBC4 in rat kidney and characterization of a novel NBC4 variant. Am J Physiol Renal Physiol. 2003 Jan;284(1):F41-50. Epub 2002 Aug 13. [PubMed:12388414 ]