You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05729
Secondary Accession Numbers
  • 11328
Name S-adenosylmethionine mitochondrial carrier protein
Synonyms
  1. Mitochondrial S-adenosylmethionine transporter
  2. Solute carrier family 25 member 26
Gene Name SLC25A26
Protein Type Enzyme
Biological Properties
General Function Involved in binding
Specific Function Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Specifically mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
S-adenosylmethionine transport
Cellular Component
nucleus
integral to membrane
mitochondrial inner membrane
Component
membrane
cell part
Function
binding
Molecular Function
S-adenosylmethionine transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 3
Locus 3p14.1
SNPs SLC25A26
Gene Sequence
>825 bp
ATGGACCGGCCGGGGTTCGTGGCAGCGCTGGTGGCTGGTGGGGTAGCAGGTGTTTCTGTT
GACTTGATATTATTTCCTCTGGATACCATTAAAACCAGGCTGCAGAGTCCCCAAGGATTT
AATAAGGCTGGTGGTTTTCATGGAATATATGCTGGCGTTCCTTCTGCTGCTATTGGATCC
TTTCCTAATGCTGCTGCATTTTTTATCACCTATGAATATGTGAAGTGGTTTTTGCATGCT
GATTCATCTTCATATTTGACACCTATGAAACATATGTTGGCTGCCTCTGCTGGAGAAGTG
GTTGCCTGCCTGATTCGAGTTCCATCTGAAGTGGTTAAGCAGAGGGCACAGGTATCTGCT
TCTACAAGAACATTTCAGATTTTCTCTAACATCTTATATGAAGAGGGTATCCAAGGGTTG
TATCGAGGCTATAAAAGCACAGTTTTAAGAGAGATTCCTTTTTCTTTGGTCCAGTTTCCC
TTATGGGAGTCCTTAAAAGCCCTCTGGTCCTGGAGGCAGGATCATGTGGTGGATTCTTGG
CAGTCAGCAGTCTGTGGAGCTTTTGCAGGTGGATTTGCCGCTGCAGTCACCACCCCTCTA
GACGTGGCAAAGACAAGAATTACGCTGGCAAAGGCTGGCTCCAGCACTGCTGATGGGAAT
GTGCTCTCTGTCCTGCATGGGGTCTGGCGGTCACAGGGGCTGGCAGGATTATTTGCAGGT
GTCTTCCCTCGAATGGCAGCCATCAGTCTGGGAGGTTTCATCTTTCTGGGGGCTTATGAC
CGAACGCACAGCTTGCTGTTGGAAGTTGGCAGAAAGAGTCCTTGA
Protein Properties
Number of Residues 274
Molecular Weight 20116.095
Theoretical pI 9.6
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>S-adenosylmethionine mitochondrial carrier protein
MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFHGIYAGVPSAAIGS
FPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSA
STRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSW
QSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAG
VFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP
GenBank ID Protein 41351486
UniProtKB/Swiss-Prot ID Q70HW3
UniProtKB/Swiss-Prot Entry Name SAMC_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ580932
GeneCard ID SLC25A26
GenAtlas ID SLC25A26
HGNC ID HGNC:20661
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Agrimi G, Di Noia MA, Marobbio CM, Fiermonte G, Lasorsa FM, Palmieri F: Identification of the human mitochondrial S-adenosylmethionine transporter: bacterial expression, reconstitution, functional characterization and tissue distribution. Biochem J. 2004 Apr 1;379(Pt 1):183-90. [PubMed:14674884 ]