You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05901
Secondary Accession Numbers
  • 11503
Name Inositol-3-phosphate synthase 1
Synonyms
  1. IPS 1
  2. MI-1-P synthase
  3. MIP synthase
  4. Myo-inositol 1-phosphate synthase A1
  5. Myo-inositol-1-phosphate synthase
  6. hINO1
  7. hIPS
  8. Myo-inositol 1-phosphate synthase
Gene Name ISYNA1
Protein Type Unknown
Biological Properties
General Function Involved in inositol-3-phosphate synthase activity
Specific Function Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.
Pathways
  • Inositol Metabolism
  • Inositol phosphate metabolism
  • Inositol Phosphate Metabolism
  • myo-inositol biosynthesis
Reactions
Glucose 6-phosphate → myo-Inositol 1-phosphate details
GO Classification
Biological Process
inositol biosynthetic process
phospholipid biosynthetic process
Cellular Component
cytoplasm
Function
binding
catalytic activity
isomerase activity
intramolecular lyase activity
inositol-3-phosphate synthase activity
Molecular Function
inositol-3-phosphate synthase activity
nucleotide binding
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
phospholipid biosynthetic process
organophosphate metabolic process
phospholipid metabolic process
inositol metabolic process
inositol biosynthetic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 19
Locus 19p13.11
SNPs ISYNA1
Gene Sequence
>1677 bp
ATGGAGGCCGCCGCCCAGTTCTTCGTCGAGAGCCCGGACGTGGTCTACGGCCCCGAGGCC
ATCGAGGCGCAATACGAGTACCGGACGACGCGCGTCAGCCGCGAGGGTGGCGTTCTCAAG
GTGCACCCCACGTCCACGCGCTTCACCTTCCGGACCGCCCGGCAGGTGCCCCGGCTCGGG
GTCATGCTTGTCGGCTGGGGCGGGAACAACGGCTCCACACTCACCGCCGCGGTGCTGGCC
AATCGACTGCGTTTGTCCTGGCCCACGCGCAGCGGCCGCAAGGAGGCCAACTACTACGGC
TCGCTGACTCAGGCGGGCACCGTGAGCCTGGGCCTGGACGCCGAGGGCCAGGAGGTGTTC
GTACCCTTCAGCGCGGTGCTGCCCATGGTGGCGCCCAACGACCTCGTGTTCGATGGCTGG
GACATCTCGTCGCTGAACCTGGCCGAGGCGATGCGGCGCGCGAAGGTGCTGGACTGGGGG
CTGCAGGAGCAACTGTGGCCGCACATGGAGGCCCTGCGGCCCCGGCCTTCTGTTTACATC
CCCGAATTCATCGCGGCCAACCAGAGCGCGCGCGCGGACAACCTCATCCCAGGCTCGCGT
GCGCAGCAGCTGGAGCAGATCCGCAGGGACATCCGAGACTTCCGGTCTAGCGCGGGGCTG
GACAAAGTCATAGTGCTGTGGACGGCGAACACGGAGCGCTTCTGTGAGGTGATTCCAGGC
CTCAACGACACAGCCGAGAACCTGCTGCGCACCATTGAGCTCGGTCTGGAGGTGTCGCCC
TCCACGCTCTTCGCCGTGGCCAGCATCCTGGAGGGCTGTGCCTTCCTCAATGGGTCTCCG
CAGAACACCCTGGTGCCCGGAGCTCTTGAGCTCGCGTGGCAGCACCGGGTTTTTGTGGGC
GGAGATGACTTCAAGTCAGGCCAGACCAAAGTCAAGTCCGTGCTTGTGGACTTCCTCATT
GGCTCCGGCCTCAAGACCATGTCCATCGTGAGTTACAACCACCTGGGCAACAACGATGGG
GAGAACCTATCGGCGCCATTGCAGTTCCGCTCTAAGGAGGTGTCCAAGAGCAACGTGGTG
GACGACATGGTGCAGAGCAACCCAGTGCTCTATACGCCCGGCGAAGAGCCTGACCACTGC
GTGGTCATCAAGTATGTGCCGTACGTGGGTGACAGCAAGCGCGCGCTGGATGAGTATACC
TCGGAGCTGATGCTGGGCGGAACCAACACACTGGTGCTGCACAACACGTGTGAGGACTCG
CTGCTGGCCGCACCCATCATGCTGGACCTAGCGCTGCTGACCGAGCTGTGCCAGCGCGTG
AGCTTCTGCACTGACATGGACCCCGAGCCGCAGACCTTCCACCCCGTGCTGTCCCTGCTC
AGCTTCCTCTTCAAGGCGCCACTAGTGCCGCCCGGCAGCCCGGTGGTCAATGCGCTTTTC
CGCCAGCGCAGCTGCATCGAGAACATCCTCAGGGCCTGCGTGGGGCTCCCGCCACAGAAC
CACATGCTCCTGGAACACAAAATGGAGCGCCCAGGGCCCAGCCTCAAGCGAGTTGGACCC
GTGGCTGCCACCTACCCTATGTTGAACAAGAAAGGACCGGTACCCGCTGCCACCAATGGC
TGCACCGGTGATGCCAATGGGCATCTGCAAGAGGAGCCCCCAATGCCCACCACCTGA
Protein Properties
Number of Residues 558
Molecular Weight 55135.445
Theoretical pI 5.035
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol-3-phosphate synthase 1
MEAAAQFFVESPDVVYGPEAIEAQYEYRTTRVSREGGVLKVHPTSTRFTFRTARQVPRLG
VMLVGWGGNNGSTLTAAVLANRLRLSWPTRSGRKEANYYGSLTQAGTVSLGLDAEGQEVF
VPFSAVLPMVAPNDLVFDGWDISSLNLAEAMRRAKVLDWGLQEQLWPHMEALRPRPSVYI
PEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLWTANTERFCEVIPG
LNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSPQNTLVPGALELAWQHRVFVG
GDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVV
DDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDS
LLAAPIMLDLALLTELCQRVSFCTDMDPEPQTFHPVLSLLSFLFKAPLVPPGSPVVNALF
RQRSCIENILRACVGLPPQNHMLLEHKMERPGPSLKRVGPVAATYPMLNKKGPVPAATNG
CTGDANGHLQEEPPMPTT
GenBank ID Protein 7705558
UniProtKB/Swiss-Prot ID Q9NPH2
UniProtKB/Swiss-Prot Entry Name INO1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_016368.4
GeneCard ID ISYNA1
GenAtlas ID ISYNA1
HGNC ID HGNC:29821
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Guan G, Dai P, Shechter I: cDNA cloning and gene expression analysis of human myo-inositol 1-phosphate synthase. Arch Biochem Biophys. 2003 Sep 15;417(2):251-9. [PubMed:12941308 ]
  5. Parthasarathy LK, Seelan RS, Tobias C, Casanova MF, Parthasarathy RN: Mammalian inositol 3-phosphate synthase: its role in the biosynthesis of brain inositol and its clinical use as a psychoactive agent. Subcell Biochem. 2006;39:293-314. [PubMed:17121280 ]
  6. Seelan RS, Parthasarathy LK, Parthasarathy RN: E2F1 regulation of the human myo-inositol 1-phosphate synthase (ISYNA1) gene promoter. Arch Biochem Biophys. 2004 Nov 1;431(1):95-106. [PubMed:15464731 ]
  7. Ju S, Shaltiel G, Shamir A, Agam G, Greenberg ML: Human 1-D-myo-inositol-3-phosphate synthase is functional in yeast. J Biol Chem. 2004 May 21;279(21):21759-65. Epub 2004 Mar 15. [PubMed:15024000 ]
  8. Shamir A, Shaltiel G, Mark S, Bersudsky Y, Belmaker RH, Agam G: Human MIP synthase splice variants in bipolar disorder. Bipolar Disord. 2007 Nov;9(7):766-71. [PubMed:17988368 ]
  9. Shaltiel G, Mark S, Kofman O, Belmaker RH, Agam G: Effect of valproate derivatives on human brain myo-inositol-1-phosphate (MIP) synthase activity and amphetamine-induced rearing. Pharmacol Rep. 2007 Jul-Aug;59(4):402-7. [PubMed:17901568 ]