You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05922
Secondary Accession Numbers
  • 11524
Name Alpha-(1,6)-fucosyltransferase
Synonyms
  1. Fucosyltransferase 8
  2. GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase
  3. GDP-fucose--glycoprotein fucosyltransferase
  4. Glycoprotein 6-alpha-L-fucosyltransferase
  5. alpha1-6FucT
Gene Name FUT8
Protein Type Enzyme
Biological Properties
General Function Involved in glycoprotein 6-alpha-L-fucosyltransferase activity
Specific Function Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.
Pathways
  • Glycosaminoglycan biosynthesis - keratan sulfate
  • N-Glycan biosynthesis
  • protein glycosylation
  • Transcriptional misregulation in cancer
Reactions
GDP-L-fucose + N(4)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6))-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-N-acetyl-beta-D-glucosaminyl)asparagine → Guanosine diphosphate + N(4)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->3)-(N-acetyl-beta-D-glucosaminyl-(1->2)-alpha-D-mannosyl-(1->6))-beta-D-mannosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->4)-(alpha-L-fucosyl-(1->6))-N-acetyl-beta-D-glucosaminyl)asparagine details
GDP-L-fucose + → GDP + details
GDP-L-fucose + → GDP + details
GO Classification
Biological Process
oligosaccharide biosynthetic process
L-fucose catabolic process
cell migration
integrin-mediated signaling pathway
N-glycan processing
protein glycosylation in Golgi
receptor metabolic process
in utero embryonic development
respiratory gaseous exchange
post-translational protein modification
protein N-linked glycosylation via asparagine
transforming growth factor beta receptor signaling pathway
Cellular Component
Golgi cisterna membrane
integral to membrane
Golgi membrane
Component
golgi membrane
membrane
cell part
membrane part
organelle membrane
intrinsic to membrane
integral to membrane
golgi cisterna membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
fucosyltransferase activity
alpha(1,6)-fucosyltransferase activity
glycoprotein 6-alpha-l-fucosyltransferase activity
Molecular Function
glycoprotein 6-alpha-L-fucosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
protein amino acid glycosylation in golgi
Cellular Location
  1. Single-pass type II membrane protein
  2. Golgi apparatus
  3. Golgi stack membrane
Gene Properties
Chromosome Location 14
Locus 14q24.3
SNPs FUT8
Gene Sequence
>1728 bp
ATGCGGCCATGGACTGGTTCCTGGCGTTGGATTATGCTCATTCTTTTTGCCTGGGGGACC
TTGCTGTTTTATATAGGTGGTCACTTGGTACGAGATAATGACCATCCTGATCACTCTAGC
CGAGAACTGTCCAAGATTCTGGCAAAGCTTGAACGCTTAAAACAACAGAATGAAGACTTG
AGGCGAATGGCCGAATCTCTCCGGATACCAGAAGGCCCTATTGATCAGGGGCCAGCTATA
GGAAGAGTACGCGTTTTAGAAGAGCAGCTTGTTAAGGCCAAAGAACAGATTGAAAATTAC
AAGAAACAGACCAGAAATGGTCTGGGGAAGGATCATGAAATCCTGAGGAGGAGGATTGAA
AATGGAGCTAAAGAGCTCTGGTTTTTCCTACAGAGTGAATTGAAGAAATTAAAGAACTTA
GAAGGAAATGAACTCCAAAGACATGCAGATGAATTTCTTTTGGATTTAGGACATCATGAA
AGGTCTATAATGACGGATCTATACTACCTCAGTCAGACAGATGGAGCAGGTGATTGGCGG
GAAAAAGAGGCCAAAGATCTGACAGAACTGGTTCAGCGGAGAATAACATATCTTCAGAAT
CCCAAGGACTGCAGCAAAGCCAAAAAGCTGGTGTGTAATATCAACAAAGGCTGTGGCTAT
GGCTGTCAGCTCCATCATGTGGTCTACTGCTTCATGATTGCATATGGCACCCAGCGAACA
CTCATCTTGGAATCTCAGAATTGGCGCTATGCTACTGGTGGATGGGAGACTGTATTTAGG
CCTGTAAGTGAGACATGCACAGACAGATCTGGCATCTCCACTGGACACTGGTCAGGTGAA
GTGAAGGACAAAAATGTTCAAGTGGTCGAGCTTCCCATTGTAGACAGTCTTCATCCCCGT
CCTCCATATTTACCCTTGGCTGTACCAGAAGACCTCGCAGATCGACTTGTACGAGTGCAT
GGTGACCCTGCAGTGTGGTGGGTGTCTCAGTTTGTCAAATACTTGATCCGCCCACAGCCT
TGGCTAGAAAAAGAAATAGAAGAAGCCACCAAGAAGCTTGGCTTCAAACATCCAGTTATT
GGAGTCCATGTCAGACGCACAGACAAAGTGGGAACAGAAGCTGCCTTCCATCCCATTGAA
GAGTACATGGTGCATGTTGAAGAACATTTTCAGCTTCTTGCACGCAGAATGCAAGTGGAC
AAAAAAAGAGTGTATTTGGCCACAGATGACCCTTCTTTATTAAAGGAGGCAAAAACAAAG
TACCCCAATTATGAATTTATTAGTGATAACTCTATTTCCTGGTCAGCTGGACTGCACAAT
CGATACACAGAAAATTCACTTCGTGGAGTGATCCTGGATATACATTTTCTCTCTCAGGCA
GACTTCCTAGTGTGTACTTTTTCATCCCAGGTCTGTCGAGTTGCTTATGAAATTATGCAA
ACACTACATCCTGATGCCTCTGCAAACTTCCATTCTTTAGATGACATCTACTATTTTGGG
GGCCAGAATGCCCACAATCAAATTGCCATTTATGCTCACCAACCCCGAACTGCAGATGAA
ATTCCCATGGAACCTGGAGATATCATTGGTGTGGCTGGAAATCATTGGGATGGCTATTCT
AAAGGTGTCAACAGGAAATTGGGAAGGACGGGCCTATATCCCTCCTACAAAGTTCGAGAG
AAGATAGAAACGGTCAAGTACCCCACATATCCTGAGGCTGAGAAATAA
Protein Properties
Number of Residues 575
Molecular Weight 66515.32
Theoretical pI 7.657
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-(1,6)-fucosyltransferase
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE
NGAKELWFFLQSELKKLKNLEGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
GenBank ID Protein 30410724
UniProtKB/Swiss-Prot ID Q9BYC5
UniProtKB/Swiss-Prot Entry Name FUT8_HUMAN
PDB IDs
GenBank Gene ID NM_178154.1
GeneCard ID FUT8
GenAtlas ID FUT8
HGNC ID HGNC:4019
References
General References
  1. Yanagidani S, Uozumi N, Ihara Y, Miyoshi E, Yamaguchi N, Taniguchi N: Purification and cDNA cloning of GDP-L-Fuc:N-acetyl-beta-D-glucosaminide:alpha1-6 fucosyltransferase (alpha1-6 FucT) from human gastric cancer MKN45 cells. J Biochem. 1997 Mar;121(3):626-32. [PubMed:9133635 ]
  2. Yamaguchi Y, Ikeda Y, Takahashi T, Ihara H, Tanaka T, Sasho C, Uozumi N, Yanagidani S, Inoue S, Fujii J, Taniguchi N: Genomic structure and promoter analysis of the human alpha1, 6-fucosyltransferase gene (FUT8). Glycobiology. 2000 Jun;10(6):637-43. [PubMed:10814706 ]
  3. Takahashi T, Ikeda Y, Tateishi A, Yamaguchi Y, Ishikawa M, Taniguchi N: A sequence motif involved in the donor substrate binding by alpha1,6-fucosyltransferase: the role of the conserved arginine residues. Glycobiology. 2000 May;10(5):503-10. [PubMed:10764839 ]