You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06156
Secondary Accession Numbers
  • 11758
Name Type I inositol 3,4-bisphosphate 4-phosphatase
Synonyms
  1. Inositol polyphosphate 4-phosphatase type I
Gene Name INPP4A
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidyl-inositol-4,5-bisphosphate 4-ph
Specific Function Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate.
Pathways
  • Inositol Metabolism
  • Inositol phosphate metabolism
  • Inositol Phosphate Metabolism
  • phosphatidylinositol signaling pathway
  • Phosphatidylinositol signaling system
Reactions
1-phosphatidyl-myo-inositol 3,4-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 3-phosphate + Phosphate details
D-myo-Inositol 3,4-bisphosphate + Water → myo-Inositol 1-phosphate + Phosphate details
1-Phosphatidyl-1D-myo-inositol 3,4-bisphosphate + Water → 1-Phosphatidyl-1D-myo-inositol 3-phosphate + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
signal transduction
phosphatidylinositol-3-phosphate biosynthetic process
Cellular Component
cytosol
Molecular Function
phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity
phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q11.2
SNPs INPP4A
Gene Sequence
>2934 bp
ATGACAGCAAGAGAGCACAGCCCTCGCCATGGTGCCAGGGCCCGTGCAATGCAGCGGGCT
TCCACCATCGACGTGGCGGCCGACATGCTGGGCCTCTCTCTGGCAGGAAATATACAAGAC
CCAGATGAGCCCATTTTAGAATTTAGCTTAGCTTGCAGTGAGCTGCATACTCCATCGCTA
GATCGAAAGCCAAATAGTTTTGTTGCGGTGAGTGTCACCACCCCTCCTCAGGCATTCTGG
ACGAAGCATGCACAGACGGAGATCATTGAGGGAACCAACAATCCTATATTTCTAAGCAGT
ATTGCCTTCTTTCAAGACTCTCTTATCAATCAGATGACACAAGTCAAACTCTCCGTGTAT
GATGTCAAAGATAGATCTCAGGGAACAATGTATTTACTGGGCTCTGGAACGTTCATTGTC
AAAGATCTGCTCCAGGACAGGCATCATAGGTTGCATTTAACACTAAGGTCTGCAGAGAGT
GACCGTGTAGGTAACATCACCGTGATTGGCTGGCAGATGGAGGAGAAGTCAGACCAACGG
CCCCCTGTGACCCGGTCTGTGGACACTGTCAATGGGAGGATGGTTCTTCCTGTCGATGAG
AGCTTGACGGAGGCGTTAGGAATCCGATCCAAATACGCTTCATTGCGAAAGGACACTTTG
CTGAAATCGGTGTTCGGTGGTGCCATCTGCCGCATGTACCGGTTTCCAACCACTGATGGT
AACCATTTGCGGATCCTGGAGCAGATGGCAGAGAGCGTGCTCTCCCTGCACGTGCCCCGG
CAGTTCGTGAAGCTCCTACTAGAGGAAGATGCAGCCAGAGTGTGTGAGCTGGAGGAGCTG
GGAGAGCTGTCCCCTTGCTGGGAGAGCCTCCGGCGCCAAATTGTCACCCAGTACCAGACC
ATCATCCTCACATACCAGGAGAACCTGACCGACCTCCATCAGTACAGAGGGCCCTCGTTT
AAAGCAAGCAGTTTGAAAGCAGATAAAAAGTTAGAATTTGTTCCCACAAACTTGCACATA
CAAAGGATGAGAGTTCAAGACGATGGAGGATCAGATCAGAACTACGACATCGTCACCATT
GGGGCGCCAGCAGCACACTGCCAAGGTTTTAAGTCAGGAGGTCTCCGCAAAAAGCTGCAC
AAATTTGAAGAGACCAAGAAACATTTTGAGGAGTGTTGTACATCATCTGGCTGCCAGTCC
ATAATCTACATACCCCAGGATGTTGTCAGAGCCAAGGAGATCATCGCCCAGATCAACACC
CTGAAAACCCAAGTGAGTTACTACGCAGAGCGGCTGTCAAGGGCAGCCAAGGACAGGTCT
GCCACTGGCCTTGAGAGGACACTCGCCATCTTGGCAGACAAGACACGGCAGCTGGTCACG
GTCTGCGACTGCAAGCTCCTGGCCAACTCCATCCATGGGCTGAACGCTGCACGGCCTGAC
TACATTGCCTCCAAGGCCTCTCCCACTTCGACTGAGGAGGAGCAGGTGATGCTTAGAAAT
GACCAGGACACCCTCATGGCCCGGTGGACAGGGAGAAACAGCCGATCTTCCCTGCAGGTG
GACTGGCACGAGGAGGAGTGGGAGAAAGTGTGGCTGAACGTGGACAAGAGCCTAGAGTGC
ATCATTCAGCGTGTGGACAAGCTGCTGCAGAAGGAGCGGCTGCATGGCGAGGGCTGTGAG
GATGTCTTCCCCTGTGCAGGCAGCTGCACCAGCAAGAAAGGTAACCCGGACAGCCACGCC
TACTGGATCAGACCAGAAGACCCCTTCTGTGATGTCCCCTCCTCACCATGCCCCTCCACC
ATGCCCTCCACTGCATGCCATCCTCATCTGACCACACATTGCAGTCCCCCTCCTGAAGAG
TCCAGCCCAGGTGAATGGAGTGAGGCCCTTTACCCGCTGCTGACCACTCTCACCGACTGC
GTGGCCATGATGAGTGACAAGGCCAAGAAGGCCATGGTATTCCTGCTCATGCAGGACAGC
GCGCCCACCATAGCCACCTACCTGAGCCTGCAGTACCGCCGTGACGTGGTCTTCTGCCAG
ACGCTGACCGCCCTCATCTGCGGCTTCATCATTAAGCTGAGGAACTGCCTGCATGACGAC
GGCTTCCTGCGCCAGCTCTACACCATCGGGCTGCTGGCCCAGTTCGAGAGCCTGCTGAGC
ACCTACGGGGAGGAGCTGGCAATGCTGGAGGACATGAGCCTTGGGATCATGGACTTGAGG
AACGTGACCTTCAAAGTCACTCAGGCCACTTCCAGCGCCTCCGCAGACATGCTGCCCGTC
ATCACAGGAAATCGCGACGGGTTTAACGTGCGGGTCCCTCTGCCGGGCCCGCTGTTTGAC
GCCTTGCCCCGGGAGATCCAGAGTGGCATGCTGCTGCGAGTGCAGCCCGTCCTCTTCAAC
GTGGGCATCAATGAGCAGCAGACACTGGCCGAGAGGTTTGGCGATACGTCTTTACAAGAA
GTCATCAACGTGGAGAGTTTGGTGCGGTTAAATTCCTACTTTGAGCAGTTTAAGGAAGTT
TTGCCTGAGGATTGCCTGCCTCGGTCTCGCAGTCAGACGTGCCTGCCAGAGCTGCTGCGG
TTTCTGGGTCAGAACGTGCATGCCCGGAAGAATAAGAACGTCGACATTCTCTGGCAAGCT
GCTGAGATCTGCCGCCGCCTTAATGGGGTCCGGTTCACCAGCTGCAAGAGCGCTAAGGAC
CGTACAGCCATGTCGGTGACACTGGAGCAGTGCCTGATCCTGCAACACGAGCATGGCATG
GCCCCGCAGGTCTTCACCCAGGCCCTGGAGTGCATGCGCAGTGAGGGTTGTCGAAGAGAA
AATACAATGAAGAATGTTGGAAGTCGCAAATATGCATTTAATTCCCTGCAGCTGAAGGCT
TTCCCCAAGCATTACAGGCCTCCCGAAGGGACTTACGGAAAAGTTGAAACGTGA
Protein Properties
Number of Residues 977
Molecular Weight 109954.68
Theoretical pI 6.964
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Type I inositol-3,4-bisphosphate 4-phosphatase
MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSL
DRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVY
DVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQR
PPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDG
NHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEELGELSPCWESLRRQIVTQYQT
IILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGGSDQNYDIVTI
GAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPD
YIASKASPTSTEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLEC
IIQRVDKLLQKERLHGEGCEDVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPST
MPSTACHPHLTTHCSPPPEESSPGEWSEALYPLLTTLTDCVAMMSDKAKKAMVFLLMQDS
APTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDDGFLRQLYTIGLLAQFESLLS
TYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNVRVPLPGPLFD
ALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKD
RTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKA
FPKHYRPPEGTYGKVET
GenBank ID Protein 197116359
UniProtKB/Swiss-Prot ID Q96PE3
UniProtKB/Swiss-Prot Entry Name INP4A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001134224.1
GeneCard ID INPP4A
GenAtlas ID INPP4A
HGNC ID HGNC:6074
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Norris FA, Atkins RC, Majerus PW: The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family. J Biol Chem. 1997 Sep 19;272(38):23859-64. [PubMed:9295334 ]
  5. Norris FA, Auethavekiat V, Majerus PW: The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase. J Biol Chem. 1995 Jul 7;270(27):16128-33. [PubMed:7608176 ]
  6. Shearn CT, Walker J, Norris FA: Identification of a novel spliceoform of inositol polyphosphate 4-phosphatase type Ialpha expressed in human platelets: structure of human inositol polyphosphate 4-phosphatase type I gene. Biochem Biophys Res Commun. 2001 Aug 10;286(1):119-25. [PubMed:11485317 ]