You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06176
Secondary Accession Numbers
  • 11778
Name Retinol dehydrogenase 10
Synonyms Not Available
Gene Name RDH10
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinol to all-trans-retinal. Has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.
Pathways
  • Retinol metabolism
Reactions
Vitamin A + NADP → Retinal + NADPH details
GO Classification
Biological Process
retinol metabolic process
in utero embryonic development
nose development
retinal metabolic process
metanephros development
visual perception
embryonic viscerocranium morphogenesis
embryonic camera-type eye development
embryonic forelimb morphogenesis
neural crest cell development
bud elongation involved in lung branching
ear development
gonad development
primary lung bud formation
retinoic acid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
cytoplasm
integral to membrane
Function
binding
catalytic activity
oxidoreductase activity
Molecular Function
retinol dehydrogenase activity
NADP-retinol dehydrogenase activity
nucleotide binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Microsome membrane
  3. Single-pass membrane protein (Potential)
  4. Single-pass membrane protein (Potential)
Gene Properties
Chromosome Location 8
Locus 8q21.11
SNPs RDH10
Gene Sequence
>1026 bp
ATGAACATCGTGGTGGAGTTCTTCGTGGTCACTTTCAAAGTGCTCTGGGCGTTCGTGCTG
GCCGCGGCGCGCTGGCTGGTGCGGCCCAAGGAGAAGAGCGTGGCGGGCCAGGTGTGCCTC
ATCACCGGCGCCGGCAGCGGCCTGGGCCGCCTCTTCGCGCTGGAGTTCGCCCGGCGTCGG
GCGCTGCTGGTGCTGTGGGACATCAACACGCAAAGCAACGAGGAGACGGCTGGCATGGTG
CGCCACATCTACCGCGACCTGGAGGCGGCCGACGCCGCTGCGCTGCAAGCTGGGAATGGT
GAGGAAGAAATTCTGCCCCACTGTAACTTGCAGGTTTTTACCTACACCTGTGACGTGGGG
AAGAGGGAGAACGTCTACCTGACGGCTGAAAGAGTCCGCAAGGAGGTTGGCGAAGTCTCA
GTCCTGGTCAATAATGCTGGTGTGGTCTCTGGGCATCACCTTCTGGAATGTCCTGATGAG
CTCATTGAGAGAACCATGATGGTCAATTGCCATGCACACTTCTGGACCACTAAGGCTTTT
CTTCCTACGATGCTGGAGATTAATCATGGTCATATTGTGACAGTTGCAAGTTCCTTGGGA
TTGTTCAGTACTGCCGGAGTTGAGGATTACTGTGCCAGTAAATTTGGAGTTGTGGGTTTT
CATGAATCCCTGAGCCATGAACTAAAGGCTGCTGAAAAGGATGGAATTAAAACAACCTTG
GTTTGCCCTTATCTTGTAGACACTGGCATGTTCAGAGGCTGCCGAATCAGGAAAGAAATT
GAGCCTTTTCTGCCACCTCTGAAGCCTGATTACTGTGTGAAGCAGGCCATGAAGGCCATC
CTCACTGACCAGCCCATGATCTGCACTCCCCGCCTCATGTACATCGTGACCTTCATGAAG
AGCATCCTACCATTTGAAGCAGTTGTGTGCATGTATCGGTTCCTAGGAGCGGACAAGTGT
ATGTACCCCTTTATTGCTCAAAGAAAGCAAGCCACAAACAATAATGAAGCAAAAAATGGA
ATCTAA
Protein Properties
Number of Residues 341
Molecular Weight 38087.16
Theoretical pI 7.4
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Retinol dehydrogenase 10
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF
LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL
VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK
SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
GenBank ID Protein 24817402
UniProtKB/Swiss-Prot ID Q8IZV5
UniProtKB/Swiss-Prot Entry Name RDH10_HUMAN
PDB IDs Not Available
GenBank Gene ID AF456765
GeneCard ID RDH10
GenAtlas ID RDH10
HGNC ID HGNC:19975
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  3. Wu BX, Chen Y, Chen Y, Fan J, Rohrer B, Crouch RK, Ma JX: Cloning and characterization of a novel all-trans retinol short-chain dehydrogenase/reductase from the RPE. Invest Ophthalmol Vis Sci. 2002 Nov;43(11):3365-72. [PubMed:12407145 ]
  4. Picozzi P, Marozzi A, Fornasari D, Benfante R, Barisani D, Meneveri R, Ginelli E: Genomic organization and transcription of the human retinol dehydrogenase 10 (RDH10) gene. FEBS Lett. 2003 Nov 6;554(1-2):59-66. [PubMed:14596915 ]