Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06336
Secondary Accession Numbers
  • 11945
Name Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
Synonyms
  1. Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form
  2. GlcNAc-T IVa
  3. GnT-IVa
  4. N-acetylglucosaminyltransferase IVa
  5. N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa
  6. UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa
Gene Name MGAT4A
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R details
UDP-N-acetyl-D-glucosamine + → UDP + details
GO Classification
Biological Process
N-glycan processing
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
extracellular region
integral to membrane
Golgi membrane
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
metal ion binding
alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Alpha-1
  2. 3-mannosyl-glycoprotein 4-beta-N- acetylglucosaminyltransferase A soluble form:Secreted
Gene Properties
Chromosome Location 2
Locus 2q12
SNPs MGAT4A
Gene Sequence
>1608 bp
ATGAGGCTCCGCAATGGAACTGTAGCCACTGCTTTAGCATTTATCACTTCCTTCCTTACT
TTGTCTTGGTATACTACATGGCAAAATGGGAAAGAAAAACTGATTGCTTATCAACGAGAA
TTCCTTGCTTTGAAAGAACGTCTTCGAATAGCTGAACACAGAATCTCACAGCGCTCTTCT
GAATTAAATACGATTGTGCAACAGTTCAAGCGTGTAGGAGCAGAAACAAATGGAAGTAAG
GATGCGTTGAATAAGTTTTCAGATAATACCCTAAAGCTGTTAAAGGAGTTAACAAGCAAA
AAATCTCTTCAAGTGCCAAGTATTTATTATCATTTGCCTCATTTATTGAAAAATGAAGGA
AGTCTTCAACCTGCTGTACAGATTGGCAACGGAAGAACAGGAGTTTCAATAGTCATGGGC
ATTCCCACAGTGAAGAGAGAAGTTAAATCTTACCTCATAGAAACTCTTCATTCCCTTATT
GATAACCTGTATCCTGAAGAGAAGTTGGACTGTGTTATAGTAGTCTTCATAGGAGAGACA
GATATTGATTATGTACATGGTGTTGTAGCCAACCTGGAGAAAGAATTTTCTAAAGAAATC
AGTTCTGGCTTGGTGGAAGTCATATCACCCCCTGAAAGCTATTATCCTGACTTGACAAAC
CTAAAGGAGACATTTGGAGACTCCAAAGAAAGAGTAAGATGGAGAACAAAGCAAAACCTA
GATTACTGTTTTCTAATGATGTATGCTCAAGAAAAGGGCATATATTACATTCAGCTTGAA
GATGATATTATTGTCAAACAAAATTATTTTAATACCATAAAAAATTTTGCACTTCAACTT
TCTTCTGAGGAATGGATGATTCTAGAGTTTTCCCAGCTGGGCTTCATTGGTAAAATGTTT
CAAGCGCCGGATCTTACTCTGATTGTAGAATTCATATTCATGTTTTACAAGGAGAAACCC
ATTGATTGGCTCCTGGACCATATTCTCTGGGTGAAAGTCTGCAACCCTGAAAAAGATGCA
AAACATTGTGATAGACAGAAAGCAAATCTGCGAATTCGCTTCAGACCTTCCCTTTTCCAA
CATGTTGGTCTGCACTCATCACTATCAGGAAAAATCCAAAAACTCACGGATAAAGATTAT
ATGAAACCATTACTTCTTAAAATCCATGTAAACCCACCTGCGGAGGTATCTACTTCCTTG
AAGGTCTACCAAGGGCATACGCTGGAGAAAACTTACATGGGAGAGGATTTCTTCTGGGCT
ATCACACCGATAGCTGGAGACTACATCTTGTTTAAATTTGATAAACCAGTCAATGTAGAA
AGTTATTTGTTCCATAGCGGCAACCAAGAACATCCTGGAGATATTCTGCTAAACACAACT
GTGGAAGTTTTGCCTTTTAAGAGTGAAGGTTTGGAAATAAGCAAAGAAACCAAAGACAAA
CGATTAGAAGATGGCTATTTCAGAATAGGAAAATTTGAGAATGGTGTTGCAGAAGGAATG
GTGGATCCAAGTCTCAATCCCATTTCAGCCTTTCGACTTTCAGTTATTCAGAATTCTGCT
GTTTGGGCCATTCTTAATGAGATTCATATTAAAAAAGCCACCAACTGA
Protein Properties
Number of Residues 535
Molecular Weight 48945.98
Theoretical pI 5.745
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
MRLRNGTVATALAFITSFLTLSWYTTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSS
ELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLKNEG
SLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGET
DIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNL
DYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMF
QAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQ
HVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWA
ITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDK
RLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UM21
UniProtKB/Swiss-Prot Entry Name MGT4A_HUMAN
PDB IDs Not Available
GenBank Gene ID AB000616
GeneCard ID MGAT4A
GenAtlas ID MGAT4A
HGNC ID HGNC:7047
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yoshida A, Minowa MT, Takamatsu S, Hara T, Oguri S, Ikenaga H, Takeuchi M: Tissue specific expression and chromosomal mapping of a human UDP-N-acetylglucosamine: alpha1,3-d-mannoside beta1, 4-N-acetylglucosaminyltransferase. Glycobiology. 1999 Mar;9(3):303-10. [PubMed:10024668 ]
  4. Takamatsu S, Oguri S, Minowa MT, Yoshida A, Nakamura K, Takeuchi M, Kobata A: Unusually high expression of N-acetylglucosaminyltransferase-IVa in human choriocarcinoma cell lines: a possible enzymatic basis of the formation of abnormal biantennary sugar chain. Cancer Res. 1999 Aug 15;59(16):3949-53. [PubMed:10463590 ]
  5. Ide Y, Miyoshi E, Nakagawa T, Gu J, Tanemura M, Nishida T, Ito T, Yamamoto H, Kozutsumi Y, Taniguchi N: Aberrant expression of N-acetylglucosaminyltransferase-IVa and IVb (GnT-IVa and b) in pancreatic cancer. Biochem Biophys Res Commun. 2006 Mar 10;341(2):478-82. Epub 2006 Jan 11. [PubMed:16434023 ]
  6. Oguri S, Yoshida A, Minowa MT, Takeuchi M: Kinetic properties and substrate specificities of two recombinant human N-acetylglucosaminyltransferase-IV isozymes. Glycoconj J. 2006 Nov;23(7-8):473-80. [PubMed:17006639 ]