Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06337
Secondary Accession Numbers
  • 11946
Name Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
Synonyms
  1. GlcNAc-T IVb
  2. GnT-IVb
  3. N-acetylglucosaminyltransferase IVb
  4. N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb
  5. UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb
Gene Name MGAT4B
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R details
UDP-N-acetyl-D-glucosamine + → UDP + details
GO Classification
Biological Process
N-glycan processing
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
integral to membrane
Golgi membrane
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
metal ion binding
alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 5
Locus 5q35
SNPs MGAT4B
Gene Sequence
>1647 bp
ATGAGGCTCCGCAATGGCACCTTCCTGACGCTGCTGCTCTTCTGCCTGTGCGCCTTCCTC
TCGCTGTCCTGGTACGCGGCACTCAGCGGCCAGAAAGGCGACGTTGTGGACGTTTACCAG
CGGGAGTTCCTGGCGCTGCGCGATCGGTTGCACGCAGCTGAGCAGGAGAGCCTCAAGCGC
TCCAAGGAGCTCAACCTGGTGCTGGACGAGATCAAGAGGGCCGTGTCAGAAAGGCAGGCG
CTGCGAGACGGAGACGGCAATCGCACCTGGGGCCGCCTAACAGAGGACCCCCGATTGAAG
CCGTGGAACGGCTCACACCGGCACGTGCTGCACCTGCCCACCGTCTTCCATCACCTGCCA
CACCTGCTGGCCAAGGAGAGCAGTCTGCAGCCCGCGGTGCGCGTGGGCCAGGGCCGCACC
GGAGTGTCGGTGGTGATGGGCATCCCGAGCGTGCGGCGCGAGGTGCACTCGTACCTGACT
GACACTCTGCACTCGCTCATCTCCGAGCTGAGCCCGCAGGAGAAGGAGGACTCGGTCATC
GTGGTGCTGATCGCCGAGACTGACTCACAGTACACTTCGGCAGTGACAGAGAACATCAAG
GCCTTGTTCCCCACGGAGATCCATTCTGGGCTCCTGGAGGTCATCTCACCCTCCCCCCAC
TTCTACCCTGACTTCTCCCGCCTCCGAGAGTCCTTTGGGGACCCCAAGGAGAGAGTCAGG
TGGAGGACCAAACAGAACCTCGATTACTGCTTCCTCATGATGTACGCGCAGTCCAAAGGC
ATCTACTACGTGCAGCTGGAGGATGACATCGTGGCCAAGCCCAACTACCTGAGCACCATG
AAGAACTTTGCACTGCAGCAGCCTTCAGAGGACTGGATGATCCTGGAGTTCTCCCAGCTG
GGCTTCATTGGTAAGATGTTCAAGTCGCTGGACCTGAGCCTGATTGTAGAGTTCATTCTC
ATGTTCTACCGGGACAAGCCCATCGACTGGCTCCTGGACCATATTCTGTGGGTGAAAGTC
TGCAACCCCGAGAAGGATGCGAAGCACTGTGACCGGCAGAAAGCCAACCTGCGGATCCGC
TTCAAACCGTCCCTCTTCCAGCACGTGGGCACTCACTCCTCGCTGGCTGGCAAGATCCAG
AAACTGAAGGACAAAGACTTTGGAAAGCAGGCGCTGCGGAAGGAGCATGTGAACCCGCCA
GCAGAGGTGAGCACGAGCCTGAAGACATACCAGCACTTCACCCTGGAGAAAGCCTACCTG
CGCGAGGACTTCTTCTGGGCCTTCACCCCTGCCGCGGGGGACTTCATCCGCTTCCGCTTC
TTCCAACCTCTAAGACTGGAGCGGTTCTTCTTCCGCAGTGGGAACATCGAGCACCCGGAG
GACAAGCTCTTCAACACGTCTGTGGAGGTGCTGCCCTTCGACAACCCTCAGTCAGACAAG
GAGGCCCTGCAGGAGGGCCGCACCGCCACCCTCCGGTACCCTCGGAGCCCCGACGGCTAC
CTCCAGATCGGCTCCTTCTACAAGGGAGTGGCAGAGGGAGAGGTGGACCCAGCCTTCGGC
CCTCTGGAAGCACTGCGCCTCTCGATCCAGACGGACTCCCCTGTGTGGGTGATTCTGAGC
GAGATCTTCCTGAAAAAGGCCGACTAA
Protein Properties
Number of Residues 548
Molecular Weight 63197.845
Theoretical pI 7.873
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQKGDVVDVYQREFLALRDRLHAAEQESLKR
SKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLP
HLLAKESSLQPAVRVGQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKEDSVI
VVLIAETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDFSRLRESFGDPKERVR
WRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNFALQQPSEDWMILEFSQL
GFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIR
FKPSLFQHVGTHSSLAGKIQKLKDKDFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYL
REDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDK
EALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILS
EIFLKKAD
GenBank ID Protein 5748487
UniProtKB/Swiss-Prot ID Q9UQ53
UniProtKB/Swiss-Prot Entry Name MGT4B_HUMAN
PDB IDs Not Available
GenBank Gene ID AB000624
GeneCard ID MGAT4B
GenAtlas ID MGAT4B
HGNC ID HGNC:7048
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  4. Ide Y, Miyoshi E, Nakagawa T, Gu J, Tanemura M, Nishida T, Ito T, Yamamoto H, Kozutsumi Y, Taniguchi N: Aberrant expression of N-acetylglucosaminyltransferase-IVa and IVb (GnT-IVa and b) in pancreatic cancer. Biochem Biophys Res Commun. 2006 Mar 10;341(2):478-82. Epub 2006 Jan 11. [PubMed:16434023 ]
  5. Oguri S, Yoshida A, Minowa MT, Takeuchi M: Kinetic properties and substrate specificities of two recombinant human N-acetylglucosaminyltransferase-IV isozymes. Glycoconj J. 2006 Nov;23(7-8):473-80. [PubMed:17006639 ]
  6. Yoshida A, Minowa MT, Takamatsu S, Hara T, Ikenaga H, Takeuchi M: A novel second isoenzyme of the human UDP-N-acetylglucosamine:alpha1,3-D-mannoside beta1,4-N-acetylglucosaminyltransferase family: cDNA cloning, expression, and chromosomal assignment. Glycoconj J. 1998 Dec;15(12):1115-23. [PubMed:10372966 ]