Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP06837
Secondary Accession Numbers
  • 12456
Name Sodium-coupled monocarboxylate transporter 2
Synonyms
  1. Electroneutral sodium monocarboxylate cotransporter
  2. Low-affinity sodium-lactate cotransporter
  3. Solute carrier family 5 member 12
Gene Name SLC5A12
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Acts as an electroneutral and low-affinity sodium (Na(+))-dependent sodium-coupled solute transporter. Catalyzes the transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, nicotinate, propionate, butyrate and beta-D- hydroxybutyrate. May be responsible for the first step of reabsorption of monocarboxylates from the lumen of the proximal tubule of the kidney and the small intestine. May play also a role in monocarboxylates transport in the retina. Mediates electroneutral uptake of lactate, with a stoichiometry of 2 Na(+) for each lactate
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11p14.2
SNPs SLC5A12
Gene Sequence
>1857 bp
ATGGAGGTGAAGAACTTTGCAGTTTGGGATTATGTTGTATTTGCAGCCCTCTTTTTCATT
TCCTCTGGAATTGGGGTGTTCTTTGCCATTAAGGAGAGAAAAAAGGCAACTTCCCGAGAG
TTCCTGGTTGGGGGAAGGCAAATGAGCTTTGGCCCTGTCGGCTTGTCTCTGACAGCCAGC
TTCATGTCAGCTGTCACGGTCCTGGGGACCCCTTCTGAAGTCTACCGCTTTGGGGCATCC
TTCCTAGTCTTCTTCATTGCTTACCTATTTGTCATCCTCTTAACATCAGAGCTCTTTCTC
CCTGTGTTCTACAGATCTGGTATCACCAGCACTTATGAGTACTTACAACTACGATTCAAC
AAACCAGTTCGCTATGCTGCCACGGTCATCTACATTGTACAGACGATTCTCTACACAGGA
GTGGTGGTGTATGCTCCTGCCCTGGCACTCAATCAAGTGACTGGGTTTGATCTCTGGGGC
TCTGTGTTTGCAACAGGAATTGTTTGCACATTCTACTGTACCCTGGGAGGATTAAAAGCA
GTGGTGTGGACAGATGCATTTCAGATGGTTGTCATGATTGTGGGCTTCTTAACGGTTCTC
ATTCAAGGATCAACTCATGCTGGGGGATTCCACAATGTATTAGAGCAATCAACAAATGGA
TCTCGACTACATATATTTGACTTTGATGTAGATCCTCTCAGGCGACACACTTTTTGGACT
ATCACAGTGGGAGGAACTTTTACTTGGCTCGGAATCTATGGGGTCAATCAATCAACTATT
CAGCGATGCATCTCTTGCAAAACAGAAAAGCATGCTAAGCTTGCCTTGTATTTTAACTTG
CTGGGTCTCTGGATCATTCTGGTGTGTGCTGTCTTCTCTGGCTTAATCATGTACTCTCAC
TTTAAAGACTGTGACCCTTGGACTTCTGGCATCATCTCAGCACCAGACCAGCTGATGCCG
TACTTTGTCATGGAGATATTTGCCACAATGCCAGGACTGCCAGGACTTTTTGTGGCTTGT
GCCTTCAGTGGAACTCTGAGCACCGTGGCTTCCAGCATCAATGCCTTGGCAACAGTGACC
TTTGAGGATTTTGTCAAGAGCTGTTTTCCTCATCTCTCCGACAAGCTGAGCACCTGGATC
AGTAAAGGCTTATGTCTCTTATTTGGCGTGATGTGTACCTCTATGGCTGTGGCTGCATCT
GTCATGGGAGGTGTTGTGCAGGCTTCCCTCAGCATTCACGGCATGTGTGGAGGACCAATG
CTGGGCTTATTCTCCCTGGGAATCGTGTTCCCTTTTGTGAATTGGAAGGGTGCACTAGGA
GGTCTTCTTACTGGAATCACCTTGTCATTTTGGGTGGCCATTGGGGCCTTCATTTACCCT
GCACCAGCCTCTAAGACATGGCCTTTGCCTCTGTCAACAGACCAATGTATCAAATCAAAT
GTGACAGCAACAGGGCCTCCAGTACTATCCAGCAGACCTGGAATAGCTGATACCTGGTAC
TCGATCTCCTACCTTTACTACAGTGCAGTGGGCTGCTTAGGATGCATTGTTGCTGGAGTA
ATCATCAGCCTCATAACAGGTCGCCAAAGAGGTGAGGATATTCAACCACTGTTAATTAGA
CCAGTTTGTAATTTATTTTGCTTTTGGTCTAAGAAGTACAAAACACTATGCTGGTGTGGA
GTTCAGCATGACAGTGGGACAGAGCAGGAAAACCTTGAGAATGGCAGTGCCCGGAAACAG
GGGGCTGAATCTGTCTTACAGAACGGACTCAGAAGAGAAAGCCTGGTACATGTTCCAGGC
TATGATCCTAAGGACAAAAGCTACAACAATATGGCATTTGAGACTACCCATTTCTAA
Protein Properties
Number of Residues 618
Molecular Weight 67646.4
Theoretical pI 8.16
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 10-30
  • 48-68
  • 83-103
  • 129-149
  • 158-178
  • 181-201
  • 236-256
  • 276-296
  • 322-342
  • 386-406
  • 412-432
  • 438-458
  • 505-525
Protein Sequence
>Sodium-coupled monocarboxylate transporter 2
MEVKNFAVWDYVVFAALFFISSGIGVFFAIKERKKATSREFLVGGRQMSFGPVGLSLTAS
FMSAVTVLGTPSEVYRFGASFLVFFIAYLFVILLTSELFLPVFYRSGITSTYEYLQLRFN
KPVRYAATVIYIVQTILYTGVVVYAPALALNQVTGFDLWGSVFATGIVCTFYCTLGGLKA
VVWTDAFQMVVMIVGFLTVLIQGSTHAGGFHNVLEQSTNGSRLHIFDFDVDPLRRHTFWT
ITVGGTFTWLGIYGVNQSTIQRCISCKTEKHAKLALYFNLLGLWIILVCAVFSGLIMYSH
FKDCDPWTSGIISAPDQLMPYFVMEIFATMPGLPGLFVACAFSGTLSTVASSINALATVT
FEDFVKSCFPHLSDKLSTWISKGLCLLFGVMCTSMAVAASVMGGVVQASLSIHGMCGGPM
LGLFSLGIVFPFVNWKGALGGLLTGITLSFWVAIGAFIYPAPASKTWPLPLSTDQCIKSN
VTATGPPVLSSRPGIADTWYSISYLYYSAVGCLGCIVAGVIISLITGRQRGEDIQPLLIR
PVCNLFCFWSKKYKTLCWCGVQHDSGTEQENLENGSARKQGAESVLQNGLRRESLVHVPG
YDPKDKSYNNMAFETTHF
GenBank ID Protein 157671931
UniProtKB/Swiss-Prot ID Q1EHB4
UniProtKB/Swiss-Prot Entry Name SC5AC_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_178498.3
GeneCard ID SLC5A12
GenAtlas ID SLC5A12
HGNC ID HGNC:28750
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Gopal E, Umapathy NS, Martin PM, Ananth S, Gnana-Prakasam JP, Becker H, Wagner CA, Ganapathy V, Prasad PD: Cloning and functional characterization of human SMCT2 (SLC5A12) and expression pattern of the transporter in kidney. Biochim Biophys Acta. 2007 Nov;1768(11):2690-7. Epub 2007 Jul 14. [PubMed:17692818 ]