Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07070
Secondary Accession Numbers
  • 12689
Name Dual oxidase 1
Synonyms
  1. Large NOX 1
  2. Long NOX 1
  3. NADPH thyroid oxidase 1
  4. Thyroid oxidase 1
Gene Name DUOX1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Generates hydrogen peroxide which is required for the activity of thyroid peroxidase/TPO and lactoperoxidase/LPO. Plays a role in thyroid hormones synthesis and lactoperoxidase-mediated antimicrobial defense at the surface of mucosa. May have its own peroxidase activity through its N-terminal peroxidase-like domain.
Pathways
  • thyroid hormone biosynthesis
  • Thyroid hormone synthesis
  • Tyrosine metabolism
Reactions
NAD(P)H + Oxygen → NAD(P)(+) + Hydrogen peroxide details
GO Classification
Biological Process
hydrogen peroxide biosynthetic process
cuticle development
cytokine-mediated signaling pathway
hormone biosynthetic process
superoxide anion generation
thyroid hormone generation
hydrogen peroxide catabolic process
response to cAMP
Cellular Component
apical plasma membrane
integral to membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
peroxidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
electron carrier activity
iron ion binding
antioxidant activity
heme binding
oxidoreductase activity
fad or fadh2 binding
calcium ion binding
Molecular Function
NADP binding
heme binding
NAD(P)H oxidase activity
peroxidase activity
calcium ion binding
Process
response to stimulus
response to stress
response to oxidative stress
metabolic process
oxidation reduction
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location 15
Locus 15q15.3
SNPs DUOX1
Gene Sequence
>4656 bp
ATGGGCTTCTGCCTGGCTCTAGCATGGACACTTCTGGTTGGGGCATGGACCCCTCTGGGA
GCTCAGAACCCCATTTCGTGGGAGGTGCAGCGATTTGATGGGTGGTACAACAACCTCATG
GAGCACAGATGGGGCAGCAAAGGCTCCCGGCTGCAGCGCCTGGTCCCAGCCAGCTATGCA
GATGGCGTGTACCAGCCCTTGGGAGAACCCCACCTGCCCAACCCCCGAGACCTTAGCAAC
ACCATCTCAAGGGGCCCTGCAGGGCTGGCCTCCCTGAGAAACCGCACAGTGTTGGGGGTC
TTCTTTGGCTATCACGTGCTTTCAGACCTGGTGAGCGTGGAAACTCCCGGCTGCCCCGCC
GAGTTCCTCAACATTCGCATCCCGCCCGGAGACCCCATGTTCGACCCCGACCAGCGCGGG
GACGTGGTGCTGCCCTTCCAGAGAAGCCGCTGGGACCCCGAGACCGGACGGAGTCCCAGC
AATCCCCGGGACCCGGCCAACCAGGTGACGGGCTGGCTGGACGGCAGCGCCATCTATGGT
TCCTCGCATTCCTGGAGCGACGCGCTGCGGAGCTTCTCCAGGGGACAGCTGGCGTCGGGG
CCCGACCCCGCTTTTCCCCGAGACTCGCAGAACCCCCTGCTCATGTGGGCGGCGCCCGAC
CCCGCCACCGGGCAGAACGGGCCCCGGGGGCTGTACGCCTTCGGGGCAGAGAGAGGGAAC
CGGGAACCCTTCCTGCAGGCGCTGGGCCTGCTCTGGTTCCGCTACCACAACCTGTGGGCG
CAGAGGCTGGCCCGCCAGCACCCAGACTGGGAGGACGAGGAGCTGTTCCAGCACGCACGC
AAGAGGGTCATCGCCACCTACCAGAACATCGCTGTGTATGAGTGGCTGCCCAGCTTCCTG
CAGAAAACACTCCCGGAGTATACAGGATACCGGCCATTTCTGGACCCCAGCATCTCCTCA
GAGTTCGTGGCGGCCTCTGAGCAGTTCCTGTCCACCATGGTGCCCCCTGGCGTCTACATG
AGAAATGCCAGCTGCCACTTCCAGGGGGTCATCAATCGGAACTCAAGTGTCTCCAGAGCT
CTCCGGGTCTGCAACAGCTACTGGAGCCGTGAGCACCCAAGCCTACAAAGTGCTGAAGAT
GTGGATGCACTGCTGCTGGGCATGGCCTCCCAGATCGCAGAGCGAGAGGACCATGTGTTG
GTTGAAGATGTGCGGGATTTCTGGCCTGGGCCACTGAAGTTTTCCCGCACAGACCACCTG
GCCAGCTGCCTGCAGCGGGGCCGGGATCTGGGCCTGCCCTCTTACACCAAGGCCAGGGCA
GCACTGGGCTTGTCTCCCATTACCCGCTGGCAGGACATCAACCCTGCACTCTCCCGGAGC
AATGACACTGTACTGGAGGCCACAGCTGCCCTGTACAACCAGGACTTATCCTGGCTAGAG
CTGCTCCCTGGGGGACTCCTGGAGAGCCACCGGGACCCTGGACCTCTGTTCAGCACCATC
GTCCTTGAACAATTTGTGCGGCTACGGGATGGTGACCGCTACTGGTTTGAGAACACCAGG
AATGGGCTGTTCTCCAAGAAGGAGATTGAAGAAATCCGAAATACCACCCTGCAGGACGTG
CTGGTCGCTGTTATCAACATTGACCCCAGTGCTCTGCAGCCCAATGTCTTTGTCTGGCAT
AAAGGAGACCCCTGTCCGCAGCCGAGACAGCTCAGCACTGAAGGCCTGCCAGCGTGTGCT
CCCTCTGTTGTTCGTGACTATTTTGAGGGCAGTGGATTTGGCTTCGGGGTCACCATCGGG
ACCCTCTGTTGCTTCCCTTTGGTGAGCCTGCTCAGTGCCTGGATTGTTGCCCGGCTCCGG
ATGAGAAATTTCAAGAGGCTCCAGGGCCAGGACCGCCAGAGCATCGTGTCTGAGAAGCTC
GTGGGAGGCATGGAAGCTTTGGAATGGCAAGGCCACAAGGAGCCCTGCCGGCCCGTGCTT
GTGTACCTGCAGCCCGGGCAGATCCGTGTGGTAGATGGCAGGCTCACCGTGCTCCGCACC
ATCCAGCTGCAGCCTCCACAGAAGGTCAACTTCGTCCTGTCCAGCAACCGTGGACGCCGC
ACTCTGCTGCTCAAGATCCCCAAGGAGTATGACCTGGTGCTGCTGTTTAACTTGGAGGAA
GAGCGGCAGGCGCTGGTGGAAAATCTCCGGGGAGCTCTGAAGGAGAGCGGGTTGAGCATC
CAGGAGTGGGAGCTGCGGGAGCAGGAGCTGATGAGAGCAGCTGTGACACGGGAGCAGCGG
AGGCACCTCCTGGAGACCTTTTTCAGGCACCTTTTCTCCCAGGTGCTGGACATCAACCAG
GCCGACGCAGGGACCCTGCCCCTGGACTCCTCCCAGAAGGTGCGGGAGGCCCTGACCTGT
GAGCTGAGCAGGGCCGAGTTTGCCGAGTCCCTGGGCCTCAAGCCCCAGGACATGTTTGTG
GAGTCCATGTTCTCTCTGGCTGACAAGGATGGCAATGGCTACCTGTCCTTCCGAGAGTTC
CTGGACATCCTGGTGGTCTTCATGAAAGGCTCTCCTGAGGAAAAGTCTCGCCTTATGTTC
CGCATGTACGACTTTGATGGGAATGGCCTCATTTCCAAGGATGAGTTCATCAGGATGCTG
AGATCCTTCATCGAGATCTCCAACAACTGCCTGTCCAAGGCCCAGCTGGCTGAGGTGGTG
GAGTCCATGTTCCGGGAGTCGGGATTCCAGGACAAGGAGGAACTGACATGGGAAGATTTT
CACTTCATGCTGCGGGACCACAATAGCGAGCTCCGCTTCACGCAGCTCTGTGTCAAAGGG
GTGGAGGTGCCTGAAGTCATCAAGGACCTCTGCCGGCGAGCCTCCTACATCAGCCAGGAT
ATGATCTGTCCCTCTCCCAGAGTGAGTGCCCGCTGTTCCCGCAGCGACATTGAGACTGAG
TTGACACCTCAGAGACTGCAGTGCCCCATGGACACAGACCCTCCCCAGGAGATTCGGCGG
AGGTTTGGCAAGAAGGTAACGTCATTCCAGCCCTTGCTGTTCACTGAGGCGCACCGAGAG
AAGTTCCAACGCAGCTGTCTCCACCAGACGGTGCAACAGTTCAAGCGCTTCATTGAGAAC
TACCGGCGCCACATCGGCTGCGTGGCCGTGTTCTACGCCATCGCTGGGGGGCTTTTCCTG
GAGAGGGCCTACTACTACGCCTTTGCCGCACATCACACGGGCATCACAGACACCACCCGC
GTGGGAATCATCCTGTCGCGGGGCACAGCAGCCAGCATCTCTTTCATGTTCTCCTACATC
TTGCTCACCATGTGCCGCAACCTCATCACCTTCCTGCGAGAAACCTTCCTCAACCGCTAC
GTGCCCTTCGACGCCGCCGTGGACTTCCATCGCCTCATTGCCTCCACCGCCATCGTCCTC
ACAGTCTTACACAGTGTGGGCCATGTGGTGAATGTGTACCTGTTCTCCATCAGCCCCCTC
AGCGTCCTCTCTTGCCTCTTTCCTGGCCTCTTCCATGATGATGGGTCTGAGCTCCCCCAG
AAGTATTACTGGTGGTTCTTCCAGACCGTACCAGGCCTCACGGGGGTTGTGCTGCTCCTG
ATCCTGGCCATCATGTATGTCTTTGCCTCCCACCACTTCCGCCGCCGCAGTTTCCGGGGC
TTCTGGCTGACCCACCACCTCTACATCCTGCTCTATGTCCTGCTCATCATCCATGGTAGC
TTTGCCCTGATCCAGCTGCCCCGTTTCCACATCTTCTTCCTGGTCCCAGCAATCATCTAT
GGGGGCGACAAGCTGGTGAGCCTGAGCCGGAAGAAGGTGGAGATCAGCGTGGTGAAGGCG
GAGCTGCTGCCCTCAGGAGTGACCCACCTGCGGTTCCAGCGGCCCCAGGGCTTTGAGTAC
AAGTCAGGGCAGTGGGTGCGGATCGCTTGCCTGGCTCTGGGGACCACCGAGTACCACCCC
TTCACACTGACCTCTGCGCCCCATGAGGACACGCTTAGCCTGCACATCCGGGCAGCAGGG
CCCTGGACCACTCGCCTCAGGGAGATCTACTCAGCCCCGACGGGTGACAGATGTGCCAGA
TACCCAAAGCTGTACCTTGATGGACCATTTGGAGAGGGCCACCAGGAGTGGCATAAGTTT
GAGGTGTCAGTGTTAGTGGGAGGGGGCATTGGGGTCACCCCTTTTGCCTCCATCCTCAAA
GACCTGGTCTTCAAGTCATCCGTCAGCTGCCAAGTGTTCTGTAAGAAGATCTACTTCATC
TGGGTGACGCGGACCCAGCGTCAGTTTGAGTGGCTGGCTGACATCATCCGAGAGGTGGAG
GAGAATGACCACCAGGACCTGGTGTCTGTGCACATCTACATCACCCAGCTGGCTGAGAAG
TTCGACCTCAGGACCACTATGCTGTACATCTGTGAGCGGCACTTCCAGAAGGTTCTGAAC
CGGAGTCTATTCACAGGCCTGCGCTCCATCACCCACTTTGGCCGTCCCCCCTTTGAGCCC
TTCTTCAACTCCCTGCAGGAGGTCCACCCCCAGGTCCGGAAGATCGGGGTGTTTAGCTGT
GGCCCCCCTGGCATGACCAAGAATGTGGAAAAGGCCTGTCAGCTCATCAACAGGCAGGAC
CGGACTCACTTCTCCCACCATTATGAGAACTTCTAG
Protein Properties
Number of Residues 1551
Molecular Weight 177233.45
Theoretical pI 7.904
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual oxidase 1
MGFCLALAWTLLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
DGVYQPLGEPHLPNPRDLSNTISRGPAGLASLRNRTVLGVFFGYHVLSDLVSVETPGCPA
EFLNIRIPPGDPMFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDPANQVTGWLDGSAIYG
SSHSWSDALRSFSRGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAFGAERGN
REPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYEWLPSFL
QKTLPEYTGYRPFLDPSISSEFVAASEQFLSTMVPPGVYMRNASCHFQGVINRNSSVSRA
LRVCNSYWSREHPSLQSAEDVDALLLGMASQIAEREDHVLVEDVRDFWPGPLKFSRTDHL
ASCLQRGRDLGLPSYTKARAALGLSPITRWQDINPALSRSNDTVLEATAALYNQDLSWLE
LLPGGLLESHRDPGPLFSTIVLEQFVRLRDGDRYWFENTRNGLFSKKEIEEIRNTTLQDV
LVAVINIDPSALQPNVFVWHKGDPCPQPRQLSTEGLPACAPSVVRDYFEGSGFGFGVTIG
TLCCFPLVSLLSAWIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVL
VYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRRTLLLKIPKEYDLVLLFNLEE
ERQALVENLRGALKESGLSIQEWELREQELMRAAVTREQRRHLLETFFRHLFSQVLDINQ
ADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFREF
LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLAEVV
ESMFRESGFQDKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQD
MICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHRE
KFQRSCLHQTVQQFKRFIENYRRHIGCVAVFYAIAGGLFLERAYYYAFAAHHTGITDTTR
VGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRLIASTAIVL
TVLHSVGHVVNVYLFSISPLSVLSCLFPGLFHDDGSELPQKYYWWFFQTVPGLTGVVLLL
ILAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPAIIY
GGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTEYHP
FTLTSAPHEDTLSLHIRAAGPWTTRLREIYSAPTGDRCARYPKLYLDGPFGEGHQEWHKF
EVSVLVGGGIGVTPFASILKDLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIREVE
ENDHQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEP
FFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF
GenBank ID Protein 20149640
UniProtKB/Swiss-Prot ID Q9NRD9
UniProtKB/Swiss-Prot Entry Name DUOX1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017434.3
GeneCard ID DUOX1
GenAtlas ID DUOX1
HGNC ID HGNC:3062
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  4. Wang D, De Deken X, Milenkovic M, Song Y, Pirson I, Dumont JE, Miot F: Identification of a novel partner of duox: EFP1, a thioredoxin-related protein. J Biol Chem. 2005 Jan 28;280(4):3096-103. Epub 2004 Nov 22. [PubMed:15561711 ]
  5. De Deken X, Wang D, Many MC, Costagliola S, Libert F, Vassart G, Dumont JE, Miot F: Cloning of two human thyroid cDNAs encoding new members of the NADPH oxidase family. J Biol Chem. 2000 Jul 28;275(30):23227-33. [PubMed:10806195 ]
  6. Edens WA, Sharling L, Cheng G, Shapira R, Kinkade JM, Lee T, Edens HA, Tang X, Sullards C, Flaherty DB, Benian GM, Lambeth JD: Tyrosine cross-linking of extracellular matrix is catalyzed by Duox, a multidomain oxidase/peroxidase with homology to the phagocyte oxidase subunit gp91phox. J Cell Biol. 2001 Aug 20;154(4):879-91. [PubMed:11514595 ]
  7. De Deken X, Wang D, Dumont JE, Miot F: Characterization of ThOX proteins as components of the thyroid H(2)O(2)-generating system. Exp Cell Res. 2002 Feb 15;273(2):187-96. [PubMed:11822874 ]
  8. Geiszt M, Witta J, Baffi J, Lekstrom K, Leto TL: Dual oxidases represent novel hydrogen peroxide sources supporting mucosal surface host defense. FASEB J. 2003 Aug;17(11):1502-4. Epub 2003 Jun 3. [PubMed:12824283 ]
  9. Schwarzer C, Machen TE, Illek B, Fischer H: NADPH oxidase-dependent acid production in airway epithelial cells. J Biol Chem. 2004 Aug 27;279(35):36454-61. Epub 2004 Jun 21. [PubMed:15210697 ]
  10. Ameziane-El-Hassani R, Morand S, Boucher JL, Frapart YM, Apostolou D, Agnandji D, Gnidehou S, Ohayon R, Noel-Hudson MS, Francon J, Lalaoui K, Virion A, Dupuy C: Dual oxidase-2 has an intrinsic Ca2+-dependent H2O2-generating activity. J Biol Chem. 2005 Aug 26;280(34):30046-54. Epub 2005 Jun 22. [PubMed:15972824 ]
  11. Harper RW, Xu C, Eiserich JP, Chen Y, Kao CY, Thai P, Setiadi H, Wu R: Differential regulation of dual NADPH oxidases/peroxidases, Duox1 and Duox2, by Th1 and Th2 cytokines in respiratory tract epithelium. FEBS Lett. 2005 Aug 29;579(21):4911-7. [PubMed:16111680 ]