Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07103
Secondary Accession Numbers
  • 12722
Name Thioredoxin reductase 3
Synonyms
  1. Thioredoxin and glutathione reductase
  2. Thioredoxin reductase TR2
Gene Name TXNRD3
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Displays thioredoxin reductase, glutaredoxin and glutathione reductase activities. Catalyzes disulfide bond isomerization. Promotes disulfide bond formation between GPX4 and various sperm proteins and may play a role in sperm maturation by promoting formation of sperm structural components (By similarity).
Pathways
  • Pyrimidine metabolism
  • Selenocompound metabolism
Reactions
Thioredoxin + NADP → thioredoxin disulfide + NADPH details
Thioredoxin + NADP → Thioredoxin disulfide + NADPH + Hydrogen Ion details
Hydrogen selenide + NADP + Water → Selenite + NADPH + Hydrogen Ion details
NADPH + Hydrogen Ion + Methylselenic acid → NADP + Water + Methaneselenol details
GO Classification
Biological Process
cell redox homeostasis
multicellular organismal development
spermatogenesis
electron transport chain
cell differentiation
Cellular Component
endoplasmic reticulum
nucleus
Component
cell part
intracellular part
cytoplasm
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
electron carrier activity
nadp or nadph binding
antioxidant activity
thioredoxin-disulfide reductase activity
oxidoreductase activity, acting on a sulfur group of donors
disulfide oxidoreductase activity
protein disulfide oxidoreductase activity
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
oxidoreductase activity, acting on a sulfur group of donors, nad or nadp as acceptor
fad or fadh2 binding
Molecular Function
electron carrier activity
thioredoxin-disulfide reductase activity
protein disulfide oxidoreductase activity
NADP binding
flavin adenine dinucleotide binding
Process
metabolic process
cellular process
oxidation reduction
cellular homeostasis
cell redox homeostasis
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Microsome
  4. Endoplasmic reticulum
Gene Properties
Chromosome Location 3
Locus 3q21.3
SNPs TXNRD3
Gene Sequence
>1932 bp
CTGGAGCGGTCGCCGCCGCAGTCGCCCGGGCCGGGAAAGGCGGGCGATGCCCCCAACCGC
CGCTCGGGCCATGTCCGAGGGGCGCGCGTGTTGTCGCCGCCGGGGCGCCGTGCCCGCCTG
TCGTCCCCCGGGCCCAGCCGCTCGTCCGAGGCCCGCGAGGAGCTGCGCCGCCACCTCGTG
GGCCTCATCGAGCGCAGCCGGGTGGTGATCTTCAGCAAGAGCTACTGTCCCCATAGTACT
CGGGTGAAAGAACTCTTTTCTTCTTTGGGAGTCGAATGTAATGTCTTGGAACTTGATCAA
GTTGATGATGGGGCCAGGGTTCAAGAAGTGCTGTCAGAAATCACTAATCAGAAAACTGTG
CCCAATATTTTCGTGAATAAAGTGCATGTAGGTGGATGTGACCAAACTTTCCAGGCATAT
CAGAGTGGTTTGTTACAGAAGCTCCTTCAGGAAGATTTGGCATATGATTATGATCTCATC
ATCATCGGTGGTGGTTCTGGAGGCCTTTCATGTGCGAAGGAAGCTGCCATTTTGGGAAAG
AAAGTTATGGTGCTAGACTTTGTTGTCCCGTCACCTCAGGGCACATCCTGGGGTCTTGGT
GGCACTTGTGTAAATGTAGGTTGTATTCCTAAGAAATTGATGCATCAGGCTGCCCTTTTG
GGGCAGGCATTATGTGACTCAAGGAAATTTGGCTGGGAATATAATCAACAAGTGAGGCAC
AACTGGGAGACAATGACAAAAGCGATTCAGAACCACATCAGCTCTCTAAACTGGGGCTAC
AGGTTGTCTCTGAGGGAAAAGGCTGTGGCCTATGTCAATTCCTATGGAGAATTTGTTGAA
CATCATAAAATAAAGGCAACCAATAAAAAAGGACAGGAGACTTATTATACTGCTGCACAG
TTTGTCATAGCAACGGGTGAAAGGCCACGGTATTTAGGAATCCAAGGAGATAAAGAATAC
TGTATTACTAGTGATGACCTTTTTTCTCTGCCTTATTGCCCTGGCAAAACATTAGTGGTG
GGTGCCTCTTATGTTGCCCTGGAGTGTGCAGGGTTTCTGGCTGGCTTTGGCCTAGATGTC
ACAGTTATGGTACGCTCAATCCTTCTCCGTGGCTTCGACCAAGAAATGGCAGAAAAAGTG
GGTTCCTACATGGAGCAGCATGGTGTGAAGTTCCTACGGAAATTCATACCTGTGATGGTT
CAACAGTTGGAGAAAGGTTCACCTGGAAAGCTGAAAGTGTTGGCTAAATCCACTGAAGGA
ACAGAAACAATTGAAGGAGTCTATAACACAGTTTTGTTAGCTATTGGTCGTGACTCCTGT
ACAAGGAAAATAGGCTTGGAGAAGATTGGTGTCAAAATTAATGAGAAGAGTGGAAAAATA
CCTGTAAATGATGTGGAACAGACCAATGTGCCATATGTCTATGCTGTTGGTGATATTTTG
GAGGATAAGCCAGAGCTCACTCCTGTCGCCATACAGTCAGGCAAGCTGCTAGCTCAGAGA
CTTTTTGGGGCCTCTTTAGAAAAGTGTGATTATATTAATGTTCCGACTACAGTGTTTACT
CCTCTGGAGTATGGTTGCTGTGGATTATCTGAAGAGAAAGCTATTGAAGTATATAAAAAA
GAGAATCTAGAAATATATCATACTTTGTTCTGGCCTCTTGAATGGACAGTAGCTGGCAGA
GAGAACAACACTTGTTACGCAAAGATAATCTGCAATAAATTCGACCATGATCGGGTGATA
GGATTTCATATTCTTGGACCAAACGCCGGTGAGGTTACCCAAGGATTTGCAGCTGCAATG
AAATGTGGGCTCACAAAACAGCTACTTGATGACACCATTGGAATTCACCCCACATGTGGG
GAGGTGTTCACGACTTTGGAAATCACAAAGTCGTCAGGACTAGACATCACTCAGAAAGGC
TGCTGAGGCTAG
Protein Properties
Number of Residues 682
Molecular Weight 66600.92
Theoretical pI 8.314
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Thioredoxin reductase 3
VRVASEGSVRRPSGPVPAPQPPAFRFVSRPGRARSESETLERSPPQSPGPGKAGDAPNRR
SGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLVGLIERSRVVIFSKSYCPHSTR
VKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFVNKVHVGGCDQTFQAYQ
SGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGKKVMVLDFVVPSPQGTSWGLGG
TCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRHNWETMTKAIQNHISSLNWGYR
LSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIATGERPRYLGIQGDKEYC
ITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVRSILLRGFDQEMAEKVG
SYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEGTETIEGVYNTVLLAIGRDSCT
RKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDILEDKPELTPVAIQSGKLLAQRL
FGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEIYHTLFWPLEWTVAGRE
NNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAMKCGLTKQLLDDTIGIHPTCGE
VFTTLEITKSSGLDITQKGCUG
GenBank ID Protein 291045266
UniProtKB/Swiss-Prot ID Q86VQ6
UniProtKB/Swiss-Prot Entry Name TRXR3_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID TXNRD3
GenAtlas ID TXNRD3
HGNC ID HGNC:20667
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  4. Sun QA, Wu Y, Zappacosta F, Jeang KT, Lee BJ, Hatfield DL, Gladyshev VN: Redox regulation of cell signaling by selenocysteine in mammalian thioredoxin reductases. J Biol Chem. 1999 Aug 27;274(35):24522-30. [PubMed:10455115 ]