You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07235
Secondary Accession Numbers
  • 12854
Name Mitochondrial glutamate carrier 1
Synonyms
  1. GC-1
  2. Glutamate/H(+) symporter 1
  3. Solute carrier family 25 member 22
Gene Name SLC25A22
Protein Type Enzyme
Biological Properties
General Function Involved in transporter activity
Specific Function Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H(+).
Pathways
  • Glucose-Alanine Cycle
Reactions Not Available
GO Classification
Cellular Component
nucleus
integral to membrane
mitochondrial inner membrane
Component
membrane
cell part
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
transporter activity
Molecular Function
symporter activity
L-glutamate transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Multi-pass membrane protein (Potential)
  2. Mitochondrion inner membrane
Gene Properties
Chromosome Location 11
Locus 11p15.5
SNPs SLC25A22
Gene Sequence
>972 bp
ATGGCTGATAAGCAGATCAGCCTGCCAGCCAAGCTCATCAATGGCGGCATCGCCGGGCTG
ATCGGTGTCACCTGCGTGTTTCCCATCGACCTGGCCAAGACCAGGCTGCAGAACCAGCAG
AACGGCCAGCGCGTGTACACGAGCATGTCCGACTGCCTCATCAAGACCGTCCGCTCCGAG
GGCTACTTCGGCATGTACCGGGGAGCTGCTGTGAACTTGACCCTCGTCACCCCCGAGAAG
GCCATCAAGCTGGCAGCCAACGACTTCTTCCGACATCAGCTCTCTAAGGACGGGCAGAAG
CTGACCCTGCTTAAAGAGATGCTGGCGGGCTGTGGGGCTGGCACCTGCCAGGTGATCGTG
ACCACGCCCATGGAGATGCTGAAGATCCAGCTGCAGGATGCAGGGCGCATTGCCGCCCAG
AGGAAGATCCTGGCTGCCCAGGGCCAGCTCTCGGCCCAGGGGGGTGCCCAGCCCTCAGTG
GAGGCTCCAGCTGCCCCTCGGCCCACGGCCACCCAGCTGACCCGCGACCTGCTGCGGAGC
CGTGGCATTGCCGGTCTCTACAAGGGACTCGGGGCCACGCTGCTCAGGGATGTCCCCTTC
TCTGTGGTGTACTTCCCGCTCTTTGCCAACCTGAACCAGCTGGGCCGCCCGGCGTCCGAG
GAGAAGTCGCCTTTCTACGTGTCCTTCCTGGCCGGCTGTGTGGCTGGGAGTGCCGCCGCT
GTGGCCGTCAACCCCTGTGATGTGGTGAAGACGCGGCTCCAGTCACTTCAGCGAGGCGTC
AACGAGGACACCTACTCTGGGATCCTGGACTGTGCCAGGAAGATCCTGCGGCACGAGGGC
CCCTCGGCCTTCCTGAAGGGCGCCTACTGCCGCGCGCTGGTCATCGCGCCCCTTTTCGGC
ATCGCACAGGTGGTCTACTTCCTGGGCATCGCGGAGTCCCTGCTGGGGCTGCTGCAGGAC
CCCCAGGCCTGA
Protein Properties
Number of Residues 323
Molecular Weight 34469.85
Theoretical pI 9.295
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Mitochondrial glutamate carrier 1
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQDPQA
GenBank ID Protein 21322705
UniProtKB/Swiss-Prot ID Q9H936
UniProtKB/Swiss-Prot Entry Name GHC1_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ428202
GeneCard ID SLC25A22
GenAtlas ID SLC25A22
HGNC ID HGNC:19954
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Fiermonte G, Palmieri L, Todisco S, Agrimi G, Palmieri F, Walker JE: Identification of the mitochondrial glutamate transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution of two human isoforms. J Biol Chem. 2002 May 31;277(22):19289-94. Epub 2002 Mar 15. [PubMed:11897791 ]
  4. Molinari F, Raas-Rothschild A, Rio M, Fiermonte G, Encha-Razavi F, Palmieri L, Palmieri F, Ben-Neriah Z, Kadhom N, Vekemans M, Attie-Bitach T, Munnich A, Rustin P, Colleaux L: Impaired mitochondrial glutamate transport in autosomal recessive neonatal myoclonic epilepsy. Am J Hum Genet. 2005 Feb;76(2):334-9. Epub 2004 Dec 8. [PubMed:15592994 ]