Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07251
Secondary Accession Numbers
  • 12870
Name tRNA (cytosine(34)-C(5))-methyltransferase
Synonyms
  1. NOL1/NOP2/Sun domain family member 2
  2. Substrate of AIM1/Aurora kinase B
  3. hTrm4
  4. tRNA (cytosine-5-)-methyltransferase
  5. tRNA methyltransferase 4 homolog
  6. Myc-induced SUN domain-containing protein
  7. Misu
Gene Name NSUN2
Protein Type Unknown
Biological Properties
General Function Involved in tRNA (cytosine-5-)-methyltransferase activity
Specific Function RNA methyltransferase that methylates tRNAs, and possibly RNA polymerase III transcripts. Methylates cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. Not able to modify tRNAs at positions 48 or 49. May act downstream of Myc to regulate epidermal cell growth and proliferation. Required for proper spindle assembly and chromosome segregation, independently of its methyltransferase activity.
Pathways Not Available
Reactions
S-Adenosylmethionine + cytosine(34) in tRNA precursor → S-Adenosylhomocysteine + 5-methylcytosine(34) in tRNA precursor details
GO Classification
Biological Process
cell division
mitosis
Cellular Component
spindle
cytoplasm
nucleolus
Molecular Function
tRNA (cytosine-5-)-methyltransferase activity
tRNA binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. nucleolus
Gene Properties
Chromosome Location 5
Locus 5p15.31
SNPs NSUN2
Gene Sequence
>2304 bp
ATGGGGCGGCGGTCGCGGGGTCGGCGGCTCCAGCAACAGCAGCGGCCGGAGGACGCGGAG
GATGGCGCCGAGGGTGGTGGAAAGCGCGGCGAGGCGGGCTGGGAAGGAGGCTACCCCGAG
ATCGTCAAGGAGAACAAGCTGTTCGAGCACTACTACCAGGAGCTCAAGATCGTGCCCGAG
GGCGAGTGGGGCCAGTTCATGGACGCTCTCAGGGAGCCGCTCCCGGCCACTTTAAGAATT
ACTGGTTACAAAAGCCACGCAAAAGAGATTCTCCATTGCTTAAAGAACAAATATTTTAAG
GAATTGGAGGACCTGGAGGTGGACGGTCAGAAAGTTGAAGTTCCACAGCCACTGAGTTGG
TATCCTGAAGAACTTGCCTGGCACACAAATTTAAGTCGAAAAATCTTGAGAAAATCGCCA
CACTTGGAAAAGTTTCATCAGTTTCTAGTTAGTGAAACAGAATCTGGAAATATTAGTCGT
CAAGAAGCTGTTAGCATGATCCCACCACTGCTCCTCAACGTGCGGCCTCATCATAAGATC
TTAGATATGTGTGCAGCACCTGGCTCAAAGACCACACAGTTAATTGAAATGCTACATGCC
GACATGAATGTCCCCTTTCCAGAGGGATTTGTTATTGCGAATGATGTGGACAACAAGCGC
TGCTACCTGCTCGTCCATCAAGCCAAGAGGCTGAGCAGCCCCTGCATCATGGTGGTCAAC
CATGATGCCTCCAGCATACCCAGGCTCCAGATAGATGTGGACGGCAGGAAAGAGATCCTC
TTCTATGATCGAATTTTATGTGATGTCCCTTGCAGTGGAGACGGCACTATGAGAAAAAAC
ATTGATGTTTGGAAAAAGTGGACCACCTTAAATAGCTTGCAGCTACATGGCTTACAGCTG
CGGATTGCAACACGCGGGGCTGAACAGCTGGCTGAAGGTGGAAGGATGGTGTATTCCACG
TGTTCACTAAACCCTATTGAGGATGAAGCAGTCATAGCATCTTTACTGGAAAAAAGTGAA
GGTGCTTTGGAGCTTGCTGATGTGTCTAATGAACTGCCAGGGCTGAAGTGGATGCCTGGA
ATCACACAGTGGAAGGTAATGACGAAAGATGGGCAGTGGTTTACAGACTGGGACGCTGTT
CCTCACAGCAGACACACCCAGATCCGACCTACCATGTTCCCTCCGAAGGACCCAGAAAAG
CTGCAGGCCATGCACCTGGAGCGATGCCTTAGGATATTACCCCATCATCAGAATACTGGA
GGGTTTTTTGTGGCAGTATTGGTGAAAAAATCTTCAATGCCGTGGAATAAACGTCAGCCA
AAGCTTCAGGGTAAATCTGCAGAGACCAGAGAAAGCACACAGCTGAGCCCTGCAGATCTC
ACAGAAGGGAAACCCACAGATCCCTCTAAGCTGGAAAGTCCGTCATTCACAGGAACTGGT
GACACAGAAATAGCTCATGCAACTGAGGATTTAGAGAATAATGGCAGTAAGAAAGATGGC
GTGTGTGGTCCTCCTCCATCAAAGAAAATGAAGTTATTTGGATTTAAAGAAGATCCATTT
GTATTTATTCCTGAAGATGACCCATTATTTCCACCTATTGAGAAATTTTATGCTTTGGAT
CCTTCATTCCCAAGGATGAATTTGTTAACTCGGACTACAGAAGGGAAGAAAAGGCAGCTC
TACATGGTTTCTAAGGAGTTGCGGAATGTGCTGCTGAATAACAGTGAGAAGATGAAGGTT
ATTAACACGGGGATCAAAGTCTGGTGTAGAAATAACAGCGGTGAAGAGTTTGACTGTGCT
TTCCGGCTGGCACGGGAGGGAATATATACATTGTATCCATTTATTAACTCAAGAATTATT
ACTGTATCAATGGAAGATGTTAAGATACTGTTGACCCAGGAAAATCCCTTTTTTAGAAAA
CTCAGCAGTGAGACCTACAGTCAAGCAAAGGACCTGGCAAAGGGAAGCATCGTGCTGAAG
TATGAACCAGATTCTGCGAATCCAGACGCTCTGCAGTGTCCCATCGTCTTATGCGGATGG
CGGGGAAAGGCCTCCATTCGAACTTTTGTGCCCAAGAATGAACGGCTTCATTATCTCAGG
ATGATGGGGCTGGAGGTATTGGGAGAAAAGAAGAAGGAAGGGGTTATCCTCACAAATGAG
AGTGCAGCCAGCACCGGACAGCCAGACAATGACGTGACTGAGGGACAGAGAGCAGGAGAG
CCCAACAGCCCAGATGCAGAAGAGGCCAACAGTCCAGACGTGACAGCAGGCTGTGACCCG
GCGGGGGTCCATCCACCCCGGTGA
Protein Properties
Number of Residues 767
Molecular Weight 82392.405
Theoretical pI 7.002
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>tRNA (cytosine-5-)-methyltransferase NSUN2
MGRRSRGRRLQQQQRPEDAEDGAEGGGKRGEAGWEGGYPEIVKENKLFEHYYQELKIVPE
GEWGQFMDALREPLPATLRITGYKSHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSW
YPEELAWHTNLSRKILRKSPHLEKFHQFLVSETESGNISRQEAVSMIPPLLLNVRPHHKI
LDMCAAPGSKTTQLIEMLHADMNVPFPEGFVIANDVDNKRCYLLVHQAKRLSSPCIMVVN
HDASSIPRLQIDVDGRKEILFYDRILCDVPCSGDGTMRKNIDVWKKWTTLNSLQLHGLQL
RIATRGAEQLAEGGRMVYSTCSLNPIEDEAVIASLLEKSEGALELADVSNELPGLKWMPG
ITQWKVMTKDGQWFTDWDAVPHSRHTQIRPTMFPPKDPEKLQAMHLERCLRILPHHQNTG
GFFVAVLVKKSSMPWNKRQPKLQGKSAETRESTQLSPADLTEGKPTDPSKLESPSFTGTG
DTEIAHATEDLENNGSKKDGVCGPPPSKKMKLFGFKEDPFVFIPEDDPLFPPIEKFYALD
PSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCA
FRLAQEGIYTLYPFINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLK
YEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLGEKKKEGVILTNE
SAASTGQPDNDVTEGQRAGEPNSPDAEEANSPDVTAGCDPAGVHPPR
GenBank ID Protein 115501316
UniProtKB/Swiss-Prot ID Q08J23
UniProtKB/Swiss-Prot Entry Name NSUN2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB255451
GeneCard ID NSUN2
GenAtlas ID NSUN2
HGNC ID HGNC:25994
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  10. Sakita-Suto S, Kanda A, Suzuki F, Sato S, Takata T, Tatsuka M: Aurora-B regulates RNA methyltransferase NSUN2. Mol Biol Cell. 2007 Mar;18(3):1107-17. Epub 2007 Jan 10. [PubMed:17215513 ]
  11. Brzezicha B, Schmidt M, Makalowska I, Jarmolowski A, Pienkowska J, Szweykowska-Kulinska Z: Identification of human tRNA:m5C methyltransferase catalysing intron-dependent m5C formation in the first position of the anticodon of the pre-tRNA Leu (CAA). Nucleic Acids Res. 2006;34(20):6034-43. Epub 2006 Oct 27. [PubMed:17071714 ]