You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07254
Secondary Accession Numbers
  • 12873
Name Transketolase-like protein 2
Synonyms Not Available
Gene Name TKTL2
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Plays an essential role in total transketolase activity and cell proliferation in cancer cells; after transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. Plays a pivotal role in carcinogenesis.
Pathways
  • Pentose phosphate pathway
Reactions
D-Sedoheptulose 7-phosphate + Glyceraldehyde 3-phosphate → D-Ribose 5-phosphate + Xylulose 5-phosphate details
Beta-D-Fructose 6-phosphate + Glyceraldehyde 3-phosphate → D-Erythrose 4-phosphate + Xylulose 5-phosphate details
D-Sedoheptulose 7-phosphate + Glyceraldehyde 3-phosphate → D-Ribose 5-phosphate + Xylulose 5-phosphate details
Beta-D-Fructose 6-phosphate + Glyceraldehyde 3-phosphate → D-Erythrose 4-phosphate + Xylulose 5-phosphate details
Aminofructose 6-phosphate + D-Ribose 5-phosphate → Iminoerythrose 4-phosphate + D-Sedoheptulose 7-phosphate details
GO Classification
Cellular Component
cytoplasm
Function
catalytic activity
Molecular Function
metal ion binding
transketolase activity
Process
metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q32.2
SNPs TKTL2
Gene Sequence
>1881 bp
ATGATGGCCAACGACGCCAAGCCCGACGTGAAGACCGTGCAGGTGCTGCGGGACACAGCC
AACCGCCTGCGGATCCATTCCATCAGGGCCACGTGTGCCTCTGGTTCTGGCCAGCTCACG
TCGTGCTGCAGTGCAGCGGAGGTCGTGTCTGTCCTCTTCTTCCACACGATGAAGTATAAA
CAGACAGACCCAGAACACCCGGACAACGACCGGTTCATCCTCTCCAGGGGACATGCTGCT
CCTATCCTCTATGCTGCTTGGGTGGAGGTGGGTGACATCAGTGAATCTGACTTGCTGAAC
CTGAGGAAACTTCACAGCGACTTGGAGAGACACCCTACCCCGCGATTGCCGTTTGTTGAC
GTGGCAACAGGGTCCCTAGGTCAGGGATTAGGTACTGCATGTGGAATGGCTTATACTGGC
AAGTACCTTGACAAGGCCAGCTACCGGGTGTTCTGCCTTATGGGAGATGGCGAATCCTCA
GAAGGCTCTGTGTGGGAGGCTTTTGCTTTTGCCTCCCACTACAACTTGGACAATCTCGTG
GCGGTCTTCGACGTGAACCGCTTGGGACAAAGTGGCCCTGCACCCCTTGAGCATGGCGCA
GACATCTACCAGAATTGCTGTGAAGCCTTTGGATGGAATACTTACTTAGTGGATGGCCAT
GATGTGGAGGCCTTGTGCCAAGCATTTTGGCAAGCAAGTCAAGTGAAGAACAAGCCTACT
GCTATAGTTGCCAAGACCTTCAAAGGTCGGGGTATTCCAAATATTGAGGATGCAGAAAAT
TGGCATGGAAAGCCAGTGCCAAAAGAAAGAGCAGATGCAATTGTCAAATTAATTGAGAGT
CAGATACAGACCAATGAGAATCTCATACCAAAATCGCCTGTGGAAGACTCACCTCAAATA
AGCATCACAGATATAAAAATGACCTCCCCACCTGCTTACAAAGTTGGTGACAAGATAGCT
ACTCAGAAAACATATGGTTTGGCTCTGGCTAAACTGGGCCGTGCAAATGAAAGAGTTATT
GTTCTGAGTGGTGACACGATGAACTCCACCTTTTCTGAGATATTCAGGAAAGAACACCCT
GAGCGTTTCATAGAGTGTATTATTGCTGAACAAAACATGGTAAGTGTGGCACTAGGCTGT
GCTACACGTGGTCGAACCATTGCTTTTGCTGGTGCTTTTGCTGCCTTTTTTACTAGAGCA
TTCGATCAGCTCCGAATGGGAGCCATTTCTCAAGCCAATATCAACCTTATTGGTTCCCAC
TGTGGGGTATCCACTGGAGAAGATGGAGTCTCCCAGATGGCCCTGGAGGATCTAGCCATG
TTCCGAAGCATTCCCAATTGTACTGTTTTCTATCCAAGTGATGCCATCTCGACAGAGCAT
GCTATTTATCTAGCCGCCAATACCAAGGGAATGTGCTTCATTCGAACCAGCCAACCAGAA
ACTGCAGTTATTTATACCCCACAAGAAAATTTTGAGATTGGCCAGGCCAAGGTGGTCCGC
CACGGTGTCAATGATAAAGTCACAGTAATTGGAGCTGGAGTTACTCTCCATGAAGCCTTA
GAAGCTGCTGACCATCTTTCTCAACAAGGTATTTCTGTCCGTGTCATCGACCCATTTACC
ATTAAACCCCTGGATGCCGCCACCATCATCTCCAGTGCAAAAGCCACAGGCGGCCGAGTT
ATCACAGTGGAGGATCACTACAGGGAAGGTGGCATTGGAGAAGCTGTTTGTGCAGCTGTC
TCCAGGGAGCCTGATATCCTTGTTCATCAACTGGCAGTGTCAGGAGTGCCTCAACGTGGG
AAAACTAGTGAATTGCTGGATATGTTTGGAATCAGTACCAGACACATTATAGCAGCCGTA
ACACTTACTTTAATGAAGTAA
Protein Properties
Number of Residues 626
Molecular Weight 67876.625
Theoretical pI 6.332
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Transketolase-like protein 2
MMANDAKPDVKTVQVLRDTANRLRIHSIRATCASGSGQLTSCCSAAEVVSVLFFHTMKYK
QTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVD
VATGSLGQGLGTACGMAYTGKYLDKASYRVFCLMGDGESSEGSVWEAFAFASHYNLDNLV
AVFDVNRLGQSGPAPLEHGADIYQNCCEAFGWNTYLVDGHDVEALCQAFWQASQVKNKPT
AIVAKTFKGRGIPNIEDAENWHGKPVPKERADAIVKLIESQIQTNENLIPKSPVEDSPQI
SITDIKMTSPPAYKVGDKIATQKTYGLALAKLGRANERVIVLSGDTMNSTFSEIFRKEHP
ERFIECIIAEQNMVSVALGCATRGRTIAFAGAFAAFFTRAFDQLRMGAISQANINLIGSH
CGVSTGEDGVSQMALEDLAMFRSIPNCTVFYPSDAISTEHAIYLAANTKGMCFIRTSQPE
TAVIYTPQENFEIGQAKVVRHGVNDKVTVIGAGVTLHEALEAADHLSQQGISVRVIDPFT
IKPLDAATIISSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG
KTSELLDMFGISTRHIIAAVTLTLMK
GenBank ID Protein 12053071
UniProtKB/Swiss-Prot ID Q9H0I9
UniProtKB/Swiss-Prot Entry Name TKTL2_HUMAN
PDB IDs Not Available
GenBank Gene ID AL136779
GeneCard ID TKTL2
GenAtlas ID TKTL2
HGNC ID HGNC:25313
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Zhang S, Yang JH, Guo CK, Cai PC: Gene silencing of TKTL1 by RNAi inhibits cell proliferation in human hepatoma cells. Cancer Lett. 2007 Aug 8;253(1):108-14. Epub 2007 Feb 23. [PubMed:17321041 ]