You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07264
Secondary Accession Numbers
  • 12883
Name NADH-cytochrome b5 reductase 2
Synonyms
  1. b5R.2
Gene Name CYB5R2
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction (By similarity). Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).
Pathways
  • Amino sugar and nucleotide sugar metabolism
Reactions
NADH + ferricytochrome b5 → NAD + Hydrogen Ion + ferrocytochrome b5 details
GO Classification
Biological Process
sterol biosynthetic process
Cellular Component
mitochondrion
membrane
Function
catalytic activity
oxidoreductase activity
Molecular Function
cytochrome-b5 reductase activity
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11p15.4
SNPs CYB5R2
Gene Sequence
>831 bp
ATGAACTCCAGGAGGAGAGAGCCAATCACCTTACAGGACCCTGAAGCCAAGTACCCGCTG
CCATTGATTGAGAAAGAGAAAATCAGCCACAACACCCGGAGGTTCCGCTTTGGACTGCCT
TCGCCGGACCATGTCTTAGGGCTTCCTGTAGGTAACTATGTCCAGCTCTTGGCAAAAATC
GATAATGAATTGGTGGTCAGGGCTTACACCCCTGTCTCCAGTGATGATGACAGAGGCTTT
GTGGACCTAATTATAAAGATCTACTTCAAAAATGTACACCCCCAATATCCTGAAGGTGGG
AAGATGACTCAGTATTTGGAGAACATGAAAATCGGGGAGACCATCTTTTTTCGAGGCCCA
AGGGGACGCTTGTTTTACCATGGGCCACGGAATCTTGGAATCAGACCAGACCAGACGAGT
GAGCCTAAAAAAACACTGGCCGATCACCTGGGAATGATTGCTGGGGGCACAGGCATCACA
CCCATGTTGCAGCTCATTCGCCACATCACCAAGGACCCCAGTGACAGGACCAGGATGTCC
CTCATCTTTGCCAACCAGACAGAGGAGGATATCTTGGTCAGAAAAGAGCTTGAAGAAATT
GCCAGGACTCACCCAGACCAGTTCGACCTGTGGTACACCCTGGACAGGCCTCCCATTGGC
TGGAAGTACAGCTCAGGCTTCGTTACTGCCGACATGATCAAGGAGCACCTTCCTCCTCCA
GCGAAGTCCACGCTCATCCTGGTGTGTGGCCCGCCAACACTGATCCAGACGGCGGCTCAC
CCTAACCTGGAGAAGCTGGGTTATACCCAGGACATGATTTTCACCTACTAA
Protein Properties
Number of Residues 276
Molecular Weight 31457.995
Theoretical pI 8.5
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH-cytochrome b5 reductase 2
MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKI
DNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGP
RGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMS
LIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTADMIKEHLPPP
AKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY
GenBank ID Protein 6166390
UniProtKB/Swiss-Prot ID Q6BCY4
UniProtKB/Swiss-Prot Entry Name NB5R2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF169802
GeneCard ID CYB5R2
GenAtlas ID CYB5R2
HGNC ID HGNC:24376
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Zhu H, Qiu H, Yoon HW, Huang S, Bunn HF: Identification of a cytochrome b-type NAD(P)H oxidoreductase ubiquitously expressed in human cells. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):14742-7. [PubMed:10611283 ]
  5. Baker MA, Krutskikh A, Curry BJ, Hetherington L, Aitken RJ: Identification of cytochrome-b5 reductase as the enzyme responsible for NADH-dependent lucigenin chemiluminescence in human spermatozoa. Biol Reprod. 2005 Aug;73(2):334-42. Epub 2005 Apr 27. [PubMed:15858218 ]