Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07265
Secondary Accession Numbers
  • 12884
Name Cytochrome b5 reductase 4
Synonyms
  1. Flavohemoprotein b5/b5R
  2. N-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containing protein
  3. b5+b5R
  4. cb5/cb5R
Gene Name CYB5R4
Protein Type Unknown
Biological Properties
General Function Involved in heme binding
Specific Function NADH-cytochrome b5 reductase involved in endoplasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS). Reduces a variety of substrates in vitro, such as cytochrome c, feericyanide and methemoglobin.
Pathways Not Available
Reactions
NADH + ferricytochrome b5 → NAD + Hydrogen Ion + ferrocytochrome b5 details
GO Classification
Biological Process
superoxide metabolic process
cell development
detection of oxygen
generation of precursor metabolites and energy
glucose homeostasis
insulin secretion
response to antibiotic
Cellular Component
endoplasmic reticulum
perinuclear region of cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
iron ion binding
heme binding
oxidoreductase activity
Molecular Function
metal ion binding
cytochrome-b5 reductase activity
heme binding
NAD(P)H oxidase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Endoplasmic reticulum
Gene Properties
Chromosome Location 6
Locus 6pter-q22.33
SNPs CYB5R4
Gene Sequence
>1566 bp
ATGCTGAACGTCCCTTCCCAGTCTTTCCCGGCCCCCAGGTCGCAGCAGCGTGTCGCCTCC
GGGGGGCGTAGCAAGGTACCTTTAAAACAGGGCAGAAGCCTTATGGATTGGATTCGACTG
ACCAAAAGTGGAAAGGATCTAACGGGATTAAAAGGCAGGTTAATTGAAGTAACTGAAGAA
GAACTTAAGAAACACAACAAAAAAGATGATTGTTGGATATGCATAAGAGGTTTCGTTTAT
AATGTCAGCCCTTATATGGAGTATCATCCTGGTGGAGAAGATGAACTAATGAGAGCAGCA
GGATCAGATGGTACTGAACTTTTTGATCAGGTTCATCGTTGGGTCAATTATGAATCCATG
CTGAAAGAATGCCTGGTTGGCAGAATGGCCATTAAACCTGCTGTTCTGAAAGACTATCGT
GAGGAGGAAAAGAAAGTCTTAAATGGCATGCTTCCCAAGAGCCAAGTGACAGATACACTT
GCCAAAGAAGGTCCTAGTTATCCAAGCTATGATTGGTTCCAAACAGACTCTTTAGTCACC
ATTGCCATATATACTAAACAGAAGGATATCAATTTAGACTCAATAATAGTTGATCATCAG
AATGATTCCTTTAGAGCAGAAACAATTATTAAGGATTGTTTATATCTTATACATATTGGG
CTAAGCCATGAGGTTCAGGAAGATTTTTCTGTGCGGGTTGTTGAGAGTGTGGGAAAAATA
GAGATTGTTCTACAAAAAAAAGAGAATACTTCTTGGGACTTTCTTGGCCATCCCCTGAAG
AATCATAATTCACTTATTCCAAGGAAAGATACAGGTTTGTACTACAGAAAGTGCCAGTTA
ATTTCCAAGGAAGATGTTACTCATGATACGAGGCTTTTCTGTTTGATGCTGCCACCAAGC
ACTCATCTTCAAGTGCCCATTGGGCAACATGTTTACCTCAAGCTACCTATTACAGGTACA
GAAATAGTAAAGCCATATACACCTGTATCTGGTTCCTTACTCTCAGAGTTCAAGGAACCA
GTTCTTCCCAACAATAAATACATCTACTTTTTGATAAAAATCTATCCCACTGGACTCTTC
ACACCAGAGCTTGATCGTCTTCAGATTGGAGATTTTGTTTCTGTAAGCAGTCCTGAGGGC
AATTTTAAAATATCCAAGTTCCAAGAATTAGAAGATCTCTTTTTGTTGGCAGCTGGAACA
GGCTTCACACCAATGGTTAAAATACTGAATTATGCTTTGACTGATATACCCAGTCTCAGG
AAAGTGAAGCTGATGTTCTTCAATAAAACAGAAGATGATATAATTTGGAGAAGCCAATTG
GAGAAATTAGCATTTAAAGATAAAAGACTGGATGTTGAATTTGTTCTCTCAGCACCTATT
TCTGAATGGAATGGCAAACAGGGACATATTTCACCAGCTCTTCTTTCTGAATTTTTGAAA
AGAAATTTGGACAAATCCAAAGTTCTCGTCTGCATTTGTGGACCAGTGCCATTTACAGAA
CAAGGAGTAAGGTTGCTGCATGATCTCAACTTTTCCAAAAATGAGATCCATAGTTTTACA
GCATAA
Protein Properties
Number of Residues 521
Molecular Weight 59473.19
Theoretical pI 7.724
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytochrome b5 reductase 4
MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEE
ELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESM
LKECLVGRMAIKPAVLKDYREEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVT
IAIYTKQKDINLDSIIVDHQNDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKI
EIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYRKCQLISKEDVTHDTRLFCLMLPPS
THLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYPTGLF
TPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLK
RNLDKSKVLVCICGPVPFTEQGVRLLHDLNFSKNEIHSFTA
GenBank ID Protein 84875541
UniProtKB/Swiss-Prot ID Q7L1T6
UniProtKB/Swiss-Prot Entry Name NB5R4_HUMAN
PDB IDs
GenBank Gene ID NM_016230.3
GeneCard ID CYB5R4
GenAtlas ID CYB5R4
HGNC ID HGNC:20147
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Zhu H, Qiu H, Yoon HW, Huang S, Bunn HF: Identification of a cytochrome b-type NAD(P)H oxidoreductase ubiquitously expressed in human cells. Proc Natl Acad Sci U S A. 1999 Dec 21;96(26):14742-7. [PubMed:10611283 ]
  5. Andersen G, Wegner L, Rose CS, Xie J, Zhu H, Larade K, Johansen A, Ek J, Lauenborg J, Drivsholm T, Borch-Johnsen K, Damm P, Hansen T, Bunn HF, Pedersen O: Variation in NCB5OR: studies of relationships to type 2 diabetes, maturity-onset diabetes of the young, and gestational diabetes mellitus. Diabetes. 2004 Nov;53(11):2992-7. [PubMed:15504981 ]
  6. Zhu H, Larade K, Jackson TA, Xie J, Ladoux A, Acker H, Berchner-Pfannschmidt U, Fandrey J, Cross AR, Lukat-Rodgers GS, Rodgers KR, Bunn HF: NCB5OR is a novel soluble NAD(P)H reductase localized in the endoplasmic reticulum. J Biol Chem. 2004 Jul 16;279(29):30316-25. Epub 2004 May 6. [PubMed:15131110 ]