Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07266
Secondary Accession Numbers
  • 12885
Name NADH-cytochrome b5 reductase-like
Synonyms Not Available
Gene Name CYB5RL
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction (By similarity).
Pathways Not Available
Reactions
NADH + ferricytochrome b5 → NAD + Hydrogen Ion + ferrocytochrome b5 details
GO Classification
Function
catalytic activity
oxidoreductase activity
Molecular Function
cytochrome-b5 reductase activity
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p32.3
SNPs CYB5RL
Gene Sequence
>948 bp
ATGATGGCTGAGAGGGAAGAGGACGACGACACTGAGGAAGCCTGGATGCAGCTACGGCCC
ACAGAACCCTTGCCTTCCCAGTGCTGCGGCAGTGGCTGCTCACCCTGTGTGTTTGACCTC
TATCACCGAGATCTGGCAAGGTGGGAGGCAGCCCAAGCCAGCAAGGACAGGAGCCTGCTG
CGTGGGCCAGAGTCACAGAGCTGCCCCTCCAAGCTGAACCCAGAGACCTTCGTGGCCTTC
TGCATCATTGCCATGGACAGGCTCACTAAGGACACCTACCGTGTCCGGTTTGCTCTACCC
GGGAACAGCCAGCTTGGCCTGCGGCCCGGCCAGCACCTCATCCTACGAGGGATAGTAGAT
GACTTAGAAATTCAGAGAGCCTATACGCCCATCAGCCCTGCCAACGCAGAAGGATACTTT
GAAGTGTTAATTAAGTGCTACCAGATGGGGCTGATGTCCCGGTATGTTGAGTCCTGGAGA
GTAGGAGACACAGCTTTCTGGCGAGGACCTTTCGGAGATTTCTTCTATAAACCAAACCAG
TATGGTGAGCTCCTCTTGCTGGCTGCGGGCACGGGCCTGGCCCCCATGGTGCCTATCCTG
CAGAGCATCACAGACAATGAGAATGACGAGACTTTTGTCACTCTGGTCGGTTGCTTCAAG
ACCTTTGAGAGCATCTACCTGAAAACCTTCCTCCAAGAGCAGGCCCGTTTCTGGAATGTC
CGTACCTTCTTTGTACTCAGCCAGGAGAGCTCCTCAGAGCAGCTTCCCTGGAGTTACCAA
GAGAAAACCCACTTTGGCCACCTGGGCCAGGACCTAATTAAAGAGCTGGTCAGCTGCTGT
CGGAGAAAGCCATTCGCACTGGTCTGTGGCTCGGCTGAGTTCACCAAAGACATAGCCAGG
TGCTTACTGTGCGCAGGCCTCACTGAGGACTCCTATTTCCTCTTCTAG
Protein Properties
Number of Residues 314
Molecular Weight 35891.57
Theoretical pI 5.152
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH-cytochrome b5 reductase-like
MAEREEDDDTEEAWMQLRPTEPLPSQCCGSGCSPCVFDLYHRDLARWEAAQASKDRSLLR
GPESQSCPSKLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVDD
LEIQRAYTPISPANAEGYFEVLIKCYQMGLMSRYVESWRVGDTAFWRGPFGDFFYKPNQY
GELLLLAAGTGLAPMVPILQSITDNENDETFVTLVGCFKTFESIYLKTFLQEQARFWNVR
TFFVLSQESSSEQLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARC
LLCAGLTEDSYFLF
GenBank ID Protein 134133308
UniProtKB/Swiss-Prot ID Q6IPT4
UniProtKB/Swiss-Prot Entry Name NB5R5_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID CYB5RL
GenAtlas ID CYB5RL
HGNC ID HGNC:32220
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]