You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07268
Secondary Accession Numbers
  • 12887
Name Mitochondrial 10-formyltetrahydrofolate dehydrogenase
Synonyms
  1. Aldehyde dehydrogenase family 1 member L2
  2. Mitochondrial 10-FTHFDH
  3. mtFDH
Gene Name ALDH1L2
Protein Type Enzyme
Biological Properties
General Function Involved in formyltetrahydrofolate dehydrogenase activity
Specific Function Not Available
Pathways
  • One carbon pool by folate
Reactions
10-Formyltetrahydrofolate + NADP + Water → Tetrahydrofolic acid + CO(2) + NADPH details
10-Formyltetrahydrofolate + NADP + Water → Tetrahydrofolic acid + Carbon dioxide + NADPH + Hydrogen Ion details
GO Classification
Biological Process
biosynthetic process
10-formyltetrahydrofolate catabolic process
methylation
one-carbon metabolic process
Cellular Component
mitochondrion
Component
cell part
intracellular part
cytoplasm
Function
binding
catalytic activity
transferase activity
oxidoreductase activity, acting on the ch-nh group of donors
glycine hydroxymethyltransferase activity
hydroxymethyl-, formyl- and related transferase activity
formyltetrahydrofolate dehydrogenase activity
cofactor binding
oxidoreductase activity, acting on the ch-nh group of donors, nad or nadp as acceptor
carboxylic acid binding
amino acid binding
phosphopantetheine binding
oxidoreductase activity
transporter activity
substrate-specific transporter activity
acyl carrier activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
formyltetrahydrofolate dehydrogenase activity
hydroxymethyl-, formyl- and related transferase activity
methyltransferase activity
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Process
metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
tetrahydrofolate metabolic process
10-formyltetrahydrofolate metabolic process
10-formyltetrahydrofolate catabolic process
cellular metabolic process
biosynthetic process
one-carbon metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q23.3
SNPs ALDH1L2
Gene Sequence
>2772 bp
ATGCTGCGGCGGGGCAGCCAGGCGCTCCGGCGCTTCTCCACTGGCCGGGTTTATTTCAAA
AACAAGCTGAAGTTGGCACTAATTGGCCAGAGCCTCTTTGGACAAGAAGTCTATAGCCAC
CTCCGCAAAGAGGGCCACCGAGTAGTAGGGGTGTTCACAGTTCCAGACAAGGATGGAAAA
GCTGACCCTCTGGCTTTGGCTGCAGAGAAAGATGGGACCCCTGTGTTCAAGCTTCCTAAA
TGGAGGGTCAAGGGCAAGACCATCAAAGAAGTGGCAGAAGCCTACAGATCCGTGGGTGCA
GAGCTAAATGTGCTCCCTTTCTGCACTCAGTTCATTCCCATGGATATAATTGATAGTCCA
AAGCACGGCTCTATCATTTATCACCCATCCATCCTGCCCAGGCACAGAGGAGCCTCTGCT
ATCAATTGGACTCTAATTATGGGAGATAAGAAAGCTGGGTTTTCTGTTTTCTGGGCTGAT
GATGGCTTGGATACAGGACCCATCCTTCTTCAGAGATCATGTGATGTTGAACCCAATGAT
ACAGTGGATGCACTTTATAATCGGTTTCTTTTTCCTGAAGGAATCAAGGCCATGGTAGAA
GCTGTCCAACTCATAGCTGATGGAAAAGCTCCTCGTATACCCCAGCCAGAAGAAGGGGCA
ACATATGAAGGTATCCAGAAAAAGGAAAATGCTGAGATTTCTTGGGACCAGTCTGCCGAA
GTTTTACATAACTGGATTCGAGGTCATGATAAAGTCCCTGGAGCTTGGACAGAGATAAAT
GGACAGATGGTCACTTTCTATGGCTCGACATTACTGAATAGCTCTGTGCCTCCTGGAGAA
CCACTGGAAATTAAAGGTGCCAAGAAGCCTGGTCTCGTTACCAAAAATGGACTTGTTCTT
TTTGGTAACGATGGAAAAGCACTGACGGTGAGAAATCTGCAGTTTGAAGATGGAAAAATG
ATCCCTGCCTCTCAGTACTTTTCAACGGGTGAGACGTCAGTGGTAGAACTGACAGCTGAA
GAGGTGAAAGTGGCAGAGACCATCAAGGTCATCTGGGCTGGAATTTTAAGCAATGTCCCC
ATTATTGAAGACTCAACAGACTTCTTTAAATCTGGAGCAAGCTCAATGGATGTTGCCAGG
CTGGTTGAAGAGATCAGACAGAAATGTGGTGGGCTTCAGTTGCAGAATGAAGATGTCTAT
ATGGCCACCAAGTTTGAAGGCTTTATCCAAAAGGTCGTGAGGAAACTGAGAGGAGAAGAT
CAAGAGGTGGAGCTGGTTGTAGATTATATTTCAAAGGAGGTCAATGAAATCATGGTAAAA
ATGCCATACCAGTGTTTCATAAATGGACAGTTCACAGATGCAGACGATGGAAAGACTTAC
GACACTATCAACCCAACAGATGGATCTACAATATGCAAAGTATCCTACGCTTCTTTGGCG
GATGTTGATAAAGCAGTAGCAGCAGCAAAAGATGCTTTTGAAAACGGTGAATGGGGAAGA
ATGAATGCAAGAGAAAGAGGAAGATTGATGTATAGACTTGCAGACCTACTGGAAGAGAAC
CAAGAAGAGCTGGCAACTATTGAAGCCCTTGATTCAGGGGCTGTCTATACCTTGGCCCTG
AAGACACACATTGGAATGTCTGTGCAAACATTCAGATATTTTGCTGGCTGGTGCGACAAA
ATTCAGGGTTCTACTATTCCAATCAACCAGGCCCGTCCAAATCGCAATCTGACCTTCACC
AAGAAAGAGCCACTCGGTGTCTGTGCCATTATTATTCCCTGGAACTACCCGCTGATGATG
CTGGCATGGAAGAGTGCTGCGTGTTTGGCAGCAGGCAATACCTTAGTGCTCAAGCCAGCA
CAGGTCACGCCCTTGACTGCTTTGAAGTTTGCAGAACTGTCTGTGAAAGCAGGCTTTCCA
AAGGGGGTCATCAACATCATTCCAGGCTCAGGTGGCATAGCAGGACAACGTCTGTCTGAA
CATCCTGACATCCGCAAACTTGGTTTCACTGGATCCACTCCTATTGGCAAACAGATCATG
AAGAGCTGTGCTGTTAGCAACTTGAAGAAAGTTTCCCTTGAGCTTGGTGGCAAGTCTCCA
CTTATAATATTTAATGACTGTGAACTTGACAAGGCTGTGCGAATGGGCATGGGAGCAGTA
TTTTTCAACAAAGGAGAGAACTGTATTGCTGCTGGGCGGTTGTTCGTGGAAGAATCCATC
CACGACGAATTTGTGACAAGAGTGGTAGAAGAAATTAAAAAGATGAAAATTGGTGATCCA
CTTGACAGATCCACTGATCATGGGCCCCAAAATCATAAGGCTCATCTGGAAAAGCTGCTG
CAATACTGTGAAACTGGAGTGAAAGAAGGGGCCACTTTGGTGTACGGGGGAAGACAAGTC
CAAAGGCCAGGCTTTTTCATGGAGCCGACCGTGTTCACAGATGTGGAAGACTACATGTAC
CTCGCCAAAGAGGAATCCTTTGGGCCTATTATGGTCATTTCTAAATTCCAAAATGGGGAC
ATCGATGGAGTGTTGCAGCGAGCAAATAGTACAGAGTATGGTTTGGCCTCAGGGGTTTTT
ACAAGAGACATAAACAAAGCTATGTATGTGAGTGAAAAACTGGAAGCAGGAACTGTTTTT
ATTAACACATACAACAAGACAGATGTGGCGGCCCCATTTGGCGGAGTTAAACAATCTGGC
TTTGGAAAAGACTTAGGTGAGGAAGCTCTAAATGAATATCTCAAAACCAAGACGGTGACA
CTGGAATATTAG
Protein Properties
Number of Residues 923
Molecular Weight 101744.98
Theoretical pI 6.524
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED
QEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
GenBank ID Protein 238814322
UniProtKB/Swiss-Prot ID Q3SY69
UniProtKB/Swiss-Prot Entry Name AL1L2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001034173.3
GeneCard ID ALDH1L2
GenAtlas ID ALDH1L2
HGNC ID HGNC:26777
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]