You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07285
Secondary Accession Numbers
  • 12904
Name Diacylglycerol kinase kappa
Synonyms
  1. 142 kDa diacylglycerol kinase
  2. DAG kinase kappa
  3. DGK-kappa
  4. Diglyceride kinase kappa
Gene Name DGKK
Protein Type Unknown
Biological Properties
General Function Involved in diacylglycerol kinase activity
Specific Function Phosphorylates diacylglycerol (DAG) to generate phosphatidic acid (PA)
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
diacylglycerol kinase activity
Process
intracellular signaling pathway
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
activation of protein kinase c activity by g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Membrane
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs DGKK
Gene Sequence
>3816 bp
ATGGACCGCGGAGCTGCCGCAGCCCAGGGCACTGCCCCGCCTCAGGATGGAGAGCAGCCC
GCTGAGTCTCCAGAGCCTCCGCCGCCTTGGCCGCCGCCGCCACCACCACCGGCTCCGCCG
CCGGCTCCGCCGCTGCTCTCCGAGGCTTCGCCAGAACCCATACCAGAGCCCTGTCCAGAG
CTTGCTCCAGGTCCCTGTCCAGAGGCGACCTCAGAATCAGCCACAGAACTGTACACAGAA
CCGACCCCAGAACCAGCCACAGAGCCGGCCTCAGAACCGGCCCCAGAACCTGCCACAGAG
CCGGCCCCAGAACCTGCCACAGAGCCGGCCCCAGAACCGGCCCCAGAACCTGCCACAGAG
TCTGCCCCAGAGCCGACTCCAGAACCTGCCCTAGAGTCGGTCCCAGAGCCGGCCCCAGAG
CTGACTCCAGAAGTTGCCCCAGAGCTGGCCCCAGAGCCGACCCCAGAACCTGTGACAGAG
CTGGCCCCAGAGTTCTGCCCTGAGGCGGCTCCAGAGTTCCGTCCAAGTCCAGCACCATGT
CTATTGCAATGTCCGGTGGACACTCGAGAGAGAGGTCTAAAGACCTCGCCATCGCCATCG
CCATCGCCATCGCCCAGAACGCCAATGTCGTGGTCCAGAATAAAGAAAATATTGAAGGAA
GGACCTATGCTGAAGAACTGTAACTCTTTCAAGAGATGGAAGCTTAGATATTTTCTGGTT
CAAGGACAGAAGCTCTACTTTGCACACCATCCCGCGTTTGCACACTTTGAAACGATTGAT
CTGTCTCAAGCCACTGTGGCAGAAAGCAGCTGTAGAAACCTTTGCCACAGTTTTTGTGTT
ATTACACCACAACGAAAAATCACTCTGGCTGCACCCAACCGGAAAGACATGGAAGAATGG
ATTAACATCATAAAAACCATCCAACAGGGAGAAATTTATAAGATACCTGCAGCAGAAAAC
AACCCTTTTCTTGTTGGAATGCATTGTTGGTACTCCAGTTACAGCCACCGGACCCAGCAC
TGCAATGTTTGTCGAGAGAGCATTCCTGCCTTATCTAGAGATGCCATCATCTGTGAAGTG
TGCAAAGTGAAATCTCACAGATTGTGTGCTTTGAGAGCAAGCAAAGACTGCAAGTGGAAT
ACATTGTCTATCACTGATGACCTCCTTCTGCCTGCAGATGAAGTAAACATGCCCCATCAA
TGGGTAGAAGGAAACATGCCTGTCAGCTCTCAGTGTGCAGTGTGTCATGAGAGCTGTGGC
AGTTATCAAAGACTTCAAGACTTCCGCTGCCTGTGGTGTAATTCTACGGTGCATGATGAC
TGTAGGAGACGGTTTTCCAAGGAATGTTGCTTCAGAAGCCATCGCTCATCAGTCATTCCT
CCCACTGCTCTAAGCGACCCCAAAGGCGATGGCCAATTAGTAGTATCTTCAGACTTCTGG
AATCTTGATTGGTCATCAGCCTGTTCATGTCCCTTGCTCATCTTCATCAACTCCAAAAGT
GGCGATCATCAGGGGATCGTCTTCCTCCGAAAATTCAAGCAATACCTTAACCCATCTCAA
GTGTTCGACTTATTGAAGGGTGGACCTGAAGCAGGGCTGTCTATGTTCAAGAACTTTGCT
CGCTTTCGCATTCTGGTTTGTGGTGGAGATGGCAGCGTGAGCTGGGTCTTATCTCTGATT
GATGCCTTTGGATTACATGAAAAGTGTCAGTTGGCAGTCATCCCACTTGGAACCGGCAAT
GATCTGGCTCGTGTTCTGGGCTGGGGTGCATTCTGGAACAAAAGCAAGTCACCTCTGGAC
ATCCTCAACAGAGTGGAGCAGGCTAGTGTGAGGATCCTAGACAGATGGAGTGTGATGATT
CGTGAGACTCCCAGACAAACCCCGCTGCTAAAAGGACAGGTTGAAATGGATGTACCACGA
TTTGAGGCTGCTGCCATCCAACACTTAGAATCTGCAGCCACCGAGTTGAACAAAATCCTG
AAGGCCAAGTACCCCACAGAGATGATCATCGCAACCAGATTCTTGTGTTCAGCTGTGGAA
GATTTTGTGGTTGATATTGTAAAGGCCTGGGGTCAGATAAAACAGAACAACACTGCAATA
GTGTCTGTGATTTTGAAAAGTGACTTAATGTATGATAGGCTCAGTGTCCTGATCGATGTC
CTGGCTGAGGAGGCAGCAGCTACTTCTGCTGAAAAAAGTGCTACAGAATATGCAGACAGC
AGCAAGGCAGATAGGAAGCCCTTCATTCCTCAAATAGACCACATAGCCAAGTGCAAGTTG
GAGCTGGCTACAAAGGCCCAGAGTCTCCAGAAATCCTTGAAACTCATCATATTTCAAGTT
GAACAAGCTCTGGATGAGGAAAGCAGACAGACAATATCTGTTAAGAACTTTAGTTCAACT
TTCTTCCTGGAAGATGACCCAGAAGATATTAACCAGACAAGCCCACGACGCCGTTCTCGT
CGTGGCACTTTGTCTTCTATATCTTCTCTCAAAAGTGAGGACCTGGACAACCTTAACTTG
GATCACTTACATTTTACACCTGAATCTATACGCTTCAAAGAAAAATGTGTCATGAACAAC
TACTTCGGAATTGGACTGGATGCTAAAATTTCTCTGGACTTCAACACCAGAAGAGATGAA
CACCCAGGGCAATACAATAGCCGCCTTAAGAACAAGATGTGGTATGGCCTTCTGGGAACC
AAAGAACTTTTGCAGCGCTCTTACAGGAAACTGGAAGAACGAGTGCATTTGGAGTGTGAT
GGAGAAACCATCTCCTTGCCAAACCTGCAAGGCATTGTAGTGCTCAACATTACCAGCTAT
GCTGGAGGTATCAACTTCTGGGGAAGCAACACAGCAACCACGGAATATGAGGCTCCTGCA
ATCGATGATGGGAAACTGGAGGTGGTGGCAATCTTTGGTTCTGTGCAGATGGCAATGTCC
CGTATCATCAACCTGCATCATCATCGCATTGCCCAGTGCCATGAGGTGATGATAACCATT
GATGGTGAAGAAGGTATCCCAGTGCAGGTGGATGGGGAGGCCTGGATTCAGAGACCAGGC
CTTATCAAAATTAGATACAAGAACGCTGCCCAGATGCTGACAAGAGATCGGGACTTTGAG
AACTCAATGAAAATGTGGGAATACAAGCATACTGAAATTCAAGCTGCCCCTCAACCCCAG
CTGGACTTCCAGGACTCTCAAGAGAGCCTCTCTGACGAGGAGTATGCCCAGATGCAGCAC
TTAGCTCGGCTTGCAGAAAACCTCATCAGCAAACTTAATGACCTGAGCAAGATCCACCAG
CATGTGTCTGTCCTCATGGGTTCTGTGAATGCCAGCGCTAACATCCTGAATGATATATTT
TACGGCCAAGACAGTGGCAATGAGATGGGTGCAGCTTCCTGTATTCCCATTGAAACTCTA
AGCAGAAATGATGCCGTAGATGTTACATTTAGTCTTAAAGGTCTCTACGATGACACCACA
GCTTTCCTGGATGAAAAGCTGCTGAGAAGTGCTGAGGATGAGACTGCACTACAAAGCGCC
CTGGATGCCATGAATAAGGAGTTCAAAAAGCTATCTGAGATTGACTGGATGAATCCAATC
TTTGTTCCAGAGGAAAAATCTTCGGACACTGACAGTAGAAGCCTCAGGCTGAAAATTAAG
TTCCCCAAATTGGGAAAGAAAAAGGTAGAAGAGGAACGCAAGCCTAAATCAGGCCAGAGT
GTCCAGAGTTTTATTGGCAATTTATGGCACCGCAGACATCGTGAAGATGAAGCAGAGGGT
GATGATCCTCTAACACCATCGAGATCTCAACTGTAG
Protein Properties
Number of Residues 1271
Molecular Weight 141827.5
Theoretical pI 5.23
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Diacylglycerol kinase kappa
MDRGAAAAQGTAPPQDGEQPAESPEPPPPWPPPPPPPAPPPAPPLLSEASPEPIPEPCPE
LAPGPCPEATSESATELYTEPTPEPATEPASEPAPEPATEPAPEPATEPAPEPAPEPATE
SAPEPTPEPALESVPEPAPELTPEVAPELAPEPTPEPVTELAPEFCPEAAPEFRPSPAPC
LLQCPVDTRERGLKTSPSPSPSPSPRTPMSWSRIKKILKEGPMLKNCNSFKRWKLRYFLV
QGQKLYFAHHPAFAHFETIDLSQATVAESSCRNLCHSFCVITPQRKITLAAPNRKDMEEW
INIIKTIQQGEIYKIPAAENNPFLVGMHCWYSSYSHRTQHCNVCRESIPALSRDAIICEV
CKVKSHRLCALRASKDCKWNTLSITDDLLLPADEVNMPHQWVEGNMPVSSQCAVCHESCG
SYQRLQDFRCLWCNSTVHDDCRRRFSKECCFRSHRSSVIPPTALSDPKGDGQLVVSSDFW
NLDWSSACSCPLLIFINSKSGDHQGIVFLRKFKQYLNPSQVFDLLKGGPEAGLSMFKNFA
RFRILVCGGDGSVSWVLSLIDAFGLHEKCQLAVIPLGTGNDLARVLGWGAFWNKSKSPLD
ILNRVEQASVRILDRWSVMIRETPRQTPLLKGQVEMDVPRFEAAAIQHLESAATELNKIL
KAKYPTEMIIATRFLCSAVEDFVVDIVKAWGQIKQNNTAIVSVILKSDLMYDRLSVLIDV
LAEEAAATSAEKSATEYADSSKADRKPFIPQIDHIAKCKLELATKAQSLQKSLKLIIFQV
EQALDEESRQTISVKNFSSTFFLEDDPEDINQTSPRRRSRRGTLSSISSLKSEDLDNLNL
DHLHFTPESIRFKEKCVMNNYFGIGLDAKISLDFNTRRDEHPGQYNSRLKNKMWYGLLGT
KELLQRSYRKLEERVHLECDGETISLPNLQGIVVLNITSYAGGINFWGSNTATTEYEAPA
IDDGKLEVVAIFGSVQMAMSRIINLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPG
LIKIRYKNAAQMLTRDRDFENSMKMWEYKHTEIQAAPQPQLDFQDSQESLSDEEYAQMQH
LARLAENLISKLNDLSKIHQHVSVLMGSVNASANILNDIFYGQDSGNEMGAASCIPIETL
SRNDAVDVTFSLKGLYDDTTAFLDEKLLRSAEDETALQSALDAMNKEFKKLSEIDWMNPI
FVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEG
DDPLTPSRSQL
GenBank ID Protein 57753888
UniProtKB/Swiss-Prot ID Q5KSL6
UniProtKB/Swiss-Prot Entry Name DGKK_HUMAN
PDB IDs Not Available
GenBank Gene ID AB183864
GeneCard ID DGKK
GenAtlas ID DGKK
HGNC ID HGNC:32395
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Imai S, Kai M, Yasuda S, Kanoh H, Sakane F: Identification and characterization of a novel human type II diacylglycerol kinase, DGK kappa. J Biol Chem. 2005 Dec 2;280(48):39870-81. Epub 2005 Oct 6. [PubMed:16210324 ]