Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07293
Secondary Accession Numbers
  • 12914
Name Phosphatidylcholine transfer protein
Synonyms
  1. PC-TP
  2. START domain-containing protein 2
  3. StAR-related lipid transfer protein 2
  4. StARD2
Gene Name PCTP
Protein Type Unknown
Biological Properties
General Function Involved in phosphatidylcholine binding
Specific Function Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21-q24
SNPs PCTP
Gene Sequence
>645 bp
ATGGAGCTGGCCGCCGGAAGCTTCTCGGAGGAGCAGTTCTGGGAGGCCTGCGCCGAGCTC
CAGCAGCCCGCTCTGGCCGGGGCCGACTGGCAGCTCCTAGTGGAGACCTCGGGCATCAGC
ATCTACCGGCTGCTGGACAAGAAGACTGGACTTTATGAGTATAAAGTCTTTGGTGTTCTG
GAGGACTGCTCACCAACTCTACTGGCAGACATCTATATGGACTCAGATTACAGAAAACAA
TGGGACCAGTATGTTAAAGAACTCTATGAACAAGAATGCAACGGAGAGACTGTGGTCTAC
TGGGAAGTGAAGTACCCTTTTCCCATGTCCAACAGAGACTATGTCTACCTTCGGCAGCGG
CGAGACCTGGACATGGAAGGGAGGAAGATCCATGTGATCCTGGCCCGGAGCACCTCCATG
CCTCAGCTTGGCGAGAGGTCTGGGGTGATCCGGGTGAAGCAATACAAGCAGAGCCTGGCG
ATCGAGAGTGACGGCAAGAAGGGGAGCAAAGTTTTCATGTATTACTTCGATAACCCGGGT
GGCCAAATTCCGTCCTGGCTCATTAACTGGGCCGCCAAGAATGGAGTTCCTAACTTCTTG
AAAGACATGGCAAGAGCCTGTCAGAACTACCTCAAGAAAACCTAA
Protein Properties
Number of Residues 214
Molecular Weight 24843.1
Theoretical pI 5.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylcholine transfer protein
MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVL
EDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQR
RDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPG
GQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
GenBank ID Protein 156151415
UniProtKB/Swiss-Prot ID Q9UKL6
UniProtKB/Swiss-Prot Entry Name PPCT_HUMAN
PDB IDs
GenBank Gene ID NM_021213.3
GeneCard ID PCTP
GenAtlas ID PCTP
HGNC ID HGNC:8752
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. van Helvoort A, de Brouwer A, Ottenhoff R, Brouwers JF, Wijnholds J, Beijnen JH, Rijneveld A, van der Poll T, van der Valk MA, Majoor D, Voorhout W, Wirtz KW, Elferink RP, Borst P: Mice without phosphatidylcholine transfer protein have no defects in the secretion of phosphatidylcholine into bile or into lung airspaces. Proc Natl Acad Sci U S A. 1999 Sep 28;96(20):11501-6. [PubMed:10500206 ]
  3. Cohen DE, Green RM, Wu MK, Beier DR: Cloning, tissue-specific expression, gene structure and chromosomal localization of human phosphatidylcholine transfer protein. Biochim Biophys Acta. 1999 Oct 28;1447(2-3):265-70. [PubMed:10542325 ]
  4. Chan WW, Roderick SL, Cohen DE: Human phosphatidylcholine transfer protein: purification, crystallization and preliminary X-ray diffraction data. Biochim Biophys Acta. 2002 Apr 1;1596(1):1-5. [PubMed:11983415 ]
  5. Roderick SL, Chan WW, Agate DS, Olsen LR, Vetting MW, Rajashankar KR, Cohen DE: Structure of human phosphatidylcholine transfer protein in complex with its ligand. Nat Struct Biol. 2002 Jul;9(7):507-11. [PubMed:12055623 ]