Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07298
Secondary Accession Numbers
  • 12919
Name Probable phospholipid-transporting ATPase VB
Synonyms
  1. ATPase class V type 10B
Gene Name ATP10B
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function ATP + H(2)O + phospholipid(In) = ADP + phosphate + phospholipid(Out)
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
substrate-specific transporter activity
lipid transporter activity
phospholipid transporter activity
phospholipid-translocating atpase activity
atpase activity, coupled to transmembrane movement of ions
atpase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
establishment of localization
transport
lipid transport
phospholipid transport
atp biosynthetic process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q34
SNPs ATP10B
Gene Sequence
>4386 bp
ATGGCCCTCTCAGTGGACTCATCGTGGCATCGGTGGCAGTGGAGAGTCAGAGATGGCTTC
CCCCATTGTCCATCGGAAACCACACCGCTGCTCTCTCCAGAGAAAGGGAGACAGAGCTAC
AACTTGACACAGCAGCGGGTCGTGTTCCCCAACAACAGCATATTCCATCAAGATTGGGAA
GAGGTCTCCAGGAGATACCCTGGCAACAGAACCTGCACAACCAAATACACCCTCTTCACC
TTCCTGCCCCGGAATCTCTTTGAGCAATTTCATAGATGGGCTAACCTCTATTTCCTGTTC
CTGGTGATTTTGAACTGGATGCCCTCCATGGAAGTCTTCCACAGAGAAATCACCATGTTA
CCATTGGCCATTGTCCTGTTCGTCATCATGATCAAGGATGGCATGGAGGACTTCAAGAGA
CACCGCTTTGATAAAGCAATAAACTGCTCCAACATTCGAATTTATGAAAGAAAAGAGCAG
ACCTATGTGCAGAAGTGCTGGAAGGATGTGCGCGTGGGAGACTTCATCCAAATGAAATGC
AATGAGATTGTCCCAGCAGACATACTCCTCCTTTTTTCCTCTGACCCCAATGGGATATGC
CATCTGGAAACTGCCAGCTTGGATGGAGAGACAAACCTCAAGCAAAGATGTGTCGTGAAG
GGCTTCTCACAGCAGGAGGTACAGTTCGAACCAGAGCTTTTCCACAATACCATCGTGTGT
GAGAAACCCAACAACCACCTCAACAAATTTAAGGGTTATATGGAGCATCCTGACCAGACC
AGGACTGGCTTTGGCTGTGAGAGTCTTCTGCTTCGAGGCTGCACCATCAGAAACACCGAG
ATGGCTGTTGGCATTGTCATCTATGCAGGCCATGAGACGAAAGCCATGCTGAACAACAGT
GGCCCCCGGTACAAACGCAGCAAGATTGAGCGGCGCATGAATATAGACATCTTCTTCTGC
ATTGGGATCCTCATCCTCATGTGCCTTATTGGAGCTGTAGGTCACAGCATCTGGAATGGG
ACCTTTGAAGAACACCCTCCCTTCGATGTGCCAGATGCCAATGGCAGCTTCCTTCCCAGT
GCCCTTGGGGGCTTCTACATGTTCCTCACAATGATCATCCTGCTCCAGGTGCTGATCCCC
ATCTCTTTGTATGTCTCCATTGAGCTGGTGAAGCTCGGGCAAGTGTTCTTCTTGAGCAAT
GACCTTGACCTGTATGATGAAGAGACCGATTTATCCATTCAATGTCGAGCCCTCAACATC
GCAGAGGACTTGGGCCAGATCCAGTACATCTTCTCCGATAAGACGGGGACCCTGACAGAG
AACAAGATGGTGTTCCGACGTTGCACCATCATGGGCAGCGAGTATTCTCACCAAGAAAAT
GCTAAGCGACTGGAGACCCCAAAGGAGCTGGACTCAGATGGTGAAGAGTGGACCCAATAC
CAATGCCTGTCCTTCTCGGCTAGATGGGCCCAGGATCCAGCAACTATGAGAAGCCAAAAA
GGTGCTCAGCCTCTGAGGAGGAGCCAGAGTGCCCGGGTGCCCATCCAGGGCCACTACCGG
CAAAGGTCTATGGGGCACCGTGAAAGCTCACAGCCTCCTGTGGCCTTCAGCAGCTCCATA
GAAAAAGATGTAACTCCAGATAAAAACCTACTGACCAAGGTTCGAGATGCTGCCCTGTGG
TTGGAGACCTTGTCAGACAGCAGACCTGCCAAGGCTTCCCTCTCCACCACCTCCTCCATT
GCTGATTTCTTCCTTGCCTTAACCATCTGCAACTCTGTCATGGTGTCCACAACCACCGAG
CCCAGGCAGAGGGTCACCATCAAACCCTCAAGCAAGGCTCTGGGGACGTCCCTGGAGAAG
ATTCAGCAGCTCTTCCAGAAGTTGAAGCTATTGAGCCTCAGCCAGTCATTCTCATCCACT
GCACCCTCTGACACAGACCTCGGGGAGAGCTTAGGGGCCAACGTGGCCACCACAGACTCG
GATGAGAGAGATGATGCATCTGTGTGCAGTGGAGGTGACTCCACTGATGACGGTGGCTAC
AGGAGCAGCATGTGGGACCAGGGCGACATCCTGGAGTCTGGGTCAGGCACTTCCTTGGAG
GAGGCATTGGAGGCCCCAGCCACAGACCTGGCCAGGCCTGAGTTCTGTTACGAGGCTGAG
AGCCCTGATGAGGCCGCCCTGGTGCACGCTGCCCATGCCTACAGCTTCACACTAGTGTCC
CGGACACCTGAGCAGGTGACTGTGCGCCTGCCCCAGGGCACCTGCCTCACCTTCAGCCTC
CTCTGCACCCTGGGCTTTGACTCTGTCAGGAAGAGAATGTCTGTGGTTGTGAGGCACCCA
CTGACTGGCGAGATTGTTGTCTACACCAAGGGTGCTGACTCGGTCATCATGGACCTGCTG
GAAGACCCAGCCTGCGTACCTGACATTAATATGGAAAAGAAGCTGAGAAAAATCCGAGCC
CGGACCCAAAAGCATCTAGACTTGTATGCAAGAGATGGCCTGCGCACACTATGCATTGCC
AAGAAGGTTGTAAGCGAAGAGGACTTCCGGAGATGGGCCAGTTTCCGGCGTGAGGCTGAG
GCATCCCTCGACAACCGAGATGAGCTTCTCATGGAAACTGCACAGCATCTGGAGAATCAA
CTCACCTTACTTGGAGCCACTGGGATCGAAGACCGGCTGCAGGAAGGAGTTCCAGATACG
ATTGCCACTCTGCGGGAGGCTGGGATCCAGCTCTGGGTCCTGACTGGAGATAAGCAGGAG
ACAGCGGTCAACATTGCCCATTCCTGCAGACTGTTAAATCAGACCGACACTGTTTATACC
ATCAATACAGAGAATCAGGAGACCTGTGAATCCATCCTCAATTGTGCATTGGAAGAGCTA
AAGCAATTTCGTGAACTACAGAAGCCAGACCGCAAGCTCTTTGGATTCCGCTTACCTTCC
AAGACACCATCCATCACCTCAGAAGCTGTGGTTCCAGAAGCTGGATTGGTCATCGATGGG
AAGACATTGAATGCCATCTTCCAGGGAAAGCTAGAGAAGAAGTTTCTGGAATTGACCCAG
TATTGTCGGTCCGTCCTGTGCTGCCGCTCCACGCCACTCCAGAAGAGTATGATAGTCAAG
CTGGTGCGAGACAAGTTGCGCGTCATGACCCTTTCCATAGGTGATGGAGCAAATGATGTA
AGCATGATTCAAGCTGCTGATATTGGAATTGGAATATCTGGACAGGAAGGCATGCAGGCT
GTCATGTCCAGCGACTTTGCCATCACCCGCTTTAAGCATCTCAAGAAGTTGCTGCTCGTG
CATGGCCACTGGTGTTACTCGCGCCTGGCCAGGATGGTGGTGTACTACCTCTACAAGAAC
GTGTGCTACGTCAACCTGCTCTTCTGGTATCAGTTCTTCTGTGGTTTCTCCAGCTCCACC
ATGATTGATTACTGGCAGATGATATTCTTCAATCTCTTCTTTACCTCCTTGCCTCCTCTT
GTCTTTGGAGTCCTTGACAAAGACATCTCTGCAGAAACACTCCTGGCATTGCCTGAGCTA
TACAAGAGTGGCCAGAACTCTGAGTGCTATAACCTGTCGACTTTCTGGATTTCTATGGTG
GATGCATTCTACCAGAGCCTCATCTGTTTCTTTATCCCTTACCTGGCCTATAAGGGCTCT
GATATAGATGTCTTTACCTTTGGGACACCAATCAACACCATCTCCCTCACCACAATCCTT
TTGCACCAGGCAATGGAAATGAAGACATGGACCATTTTCCACGGAGTCGTGCTCCTCGGC
AGCTTCCTGATGTACTTTCTGGTATCCCTCCTGTACAATGCCACCTGCGTCATCTGCAAC
AGCCCCACCAATCCCTATTGGGTGATGGAAGGCCAGCTCTCAAACCCCACTTTCTACCTC
GTCTGCTTTCTCACACCAGTTGTTGCTCTTCTCCCAAGATACTTTTTCCTGTCTCTGCAA
GGAACTTGTGGGAAGTCTCTAATCTCAAAAGCTCAGAAAATTGACAAACTCCCCCCAGAC
AAAAGAAACCTGGAAATCCAGAGTTGGAGAAGCAGACAGAGGCCTGCCCCTGTCCCCGAA
GTGGCTCGACCAACTCACCACCCAGTGTCATCTATCACAGGACAGGACTTCAGTGCCAGC
ACCCCAAAGAGCTCTAACCCTCCCAAGAGGAAGCATGTGGAAGAGTCAGTACTCCACGAA
CAGAGATGTGGCACGGAGTGCATGAGGGATGACTCATGCTCAGGGGACTCCTCAGCTCAA
CTCTCATCCGGGGAGCACCTGCTGGGACCTAACAGGATAATGGCCTACTCAAGAGGACAG
ACTGATATGTGCCGGTGCTCAAAGAGGAGCAGCCATCGCCGATCCCAGAGTTCACTGACC
ATATGA
Protein Properties
Number of Residues 1461
Molecular Weight 165388.9
Theoretical pI 6.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 83-104
  • 111-132
  • 317-338
  • 369-390
  • 1112-1132
  • 1145-1164
  • 1195-1216
  • 1224-1246
  • 1253-1273
  • 1292-1316
Protein Sequence
>Probable phospholipid-transporting ATPase VB
MALSVDSSWHRWQWRVRDGFPHCPSETTPLLSPEKGRQSYNLTQQRVVFPNNSIFHQDWE
EVSRRYPGNRTCTTKYTLFTFLPRNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITML
PLAIVLFVIMIKDGMEDFKRHRFDKAINCSNIRIYERKEQTYVQKCWKDVRVGDFIQMKC
NEIVPADILLLFSSDPNGICHLETASLDGETNLKQRCVVKGFSQQEVQFEPELFHNTIVC
EKPNNHLNKFKGYMEHPDQTRTGFGCESLLLRGCTIRNTEMAVGIVIYAGHETKAMLNNS
GPRYKRSKIERRMNIDIFFCIGILILMCLIGAVGHSIWNGTFEEHPPFDVPDANGSFLPS
ALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFFLSNDLDLYDEETDLSIQCRALNI
AEDLGQIQYIFSDKTGTLTENKMVFRRCTIMGSEYSHQENAKRLETPKELDSDGEEWTQY
QCLSFSARWAQDPATMRSQKGAQPLRRSQSARVPIQGHYRQRSMGHRESSQPPVAFSSSI
EKDVTPDKNLLTKVRDAALWLETLSDSRPAKASLSTTSSIADFFLALTICNSVMVSTTTE
PRQRVTIKPSSKALGTSLEKIQQLFQKLKLLSLSQSFSSTAPSDTDLGESLGANVATTDS
DERDDASVCSGGDSTDDGGYRSSMWDQGDILESGSGTSLEEALEAPATDLARPEFCYEAE
SPDEAALVHAAHAYSFTLVSRTPEQVTVRLPQGTCLTFSLLCTLGFDSVRKRMSVVVRHP
LTGEIVVYTKGADSVIMDLLEDPACVPDINMEKKLRKIRARTQKHLDLYARDGLRTLCIA
KKVVSEEDFRRWASFRREAEASLDNRDELLMETAQHLENQLTLLGATGIEDRLQEGVPDT
IATLREAGIQLWVLTGDKQETAVNIAHSCRLLNQTDTVYTINTENQETCESILNCALEEL
KQFRELQKPDRKLFGFRLPSKTPSITSEAVVPEAGLVIDGKTLNAIFQGKLEKKFLELTQ
YCRSVLCCRSTPLQKSMIVKLVRDKLRVMTLSIGDGANDVSMIQAADIGIGISGQEGMQA
VMSSDFAITRFKHLKKLLLVHGHWCYSRLARMVVYYLYKNVCYVNLLFWYQFFCGFSSST
MIDYWQMIFFNLFFTSLPPLVFGVLDKDISAETLLALPELYKSGQNSECYNLSTFWISMV
DAFYQSLICFFIPYLAYKGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTIFHGVVLLG
SFLMYFLVSLLYNATCVICNSPTNPYWVMEGQLSNPTFYLVCFLTPVVALLPRYFFLSLQ
GTCGKSLISKAQKIDKLPPDKRNLEIQSWRSRQRPAPVPEVARPTHHPVSSITGQDFSAS
TPKSSNPPKRKHVEESVLHEQRCGTECMRDDSCSGDSSAQLSSGEHLLGPNRIMAYSRGQ
TDMCRCSKRSSHRRSQSSLTI
GenBank ID Protein 149944474
UniProtKB/Swiss-Prot ID O94823
UniProtKB/Swiss-Prot Entry Name AT10B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_025153.2
GeneCard ID ATP10B
GenAtlas ID ATP10B
HGNC ID HGNC:13543
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  3. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]