You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07299
Secondary Accession Numbers
  • 12920
  • HMDBP09530
Name Probable phospholipid-transporting ATPase ID
Synonyms
  1. ATPase class I type 8B member 2
Gene Name ATP8B2
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function ATP + H(2)O + phospholipid(In) = ADP + phosphate + phospholipid(Out)
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
cell
Function
ion binding
cation binding
metal ion binding
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
ion transporter activity
cation transporter activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
substrate-specific transporter activity
lipid transporter activity
phospholipid transporter activity
phospholipid-translocating atpase activity
atpase activity, coupled to transmembrane movement of ions
atpase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
hydrolase activity, acting on acid anhydrides
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
establishment of localization
transport
physiological process
cellular physiological process
lipid transport
phospholipid transport
ion transport
atp biosynthetic process
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.3
SNPs ATP8B2
Gene Sequence
>3672 bp
ATGGATACCTTGAGAGCTGTTCCCCTTTTTTCAATATCTGGCCTCTTCTCCTTTCCCTAC
AGGGTCTCCCATGGGATTGCTGGGATCTTGCTGGGTGAGATGGCAGTGTGTGCAAAAAAG
CGCCCCCCAGAAGAAGAAAGGAGGGCGCGGGCTAATGACCGAGAATACAATGAGAAATTC
CAGTATGCGAGTAACTGCATCAAGACCTCCAAGTACAATATTCTCACCTTCCTGCCTGTC
AACCTCTTTGAGCAGTTCCAGGAAGTTGCCAACACTTACTTCCTGTTCCTCCTCATTCTG
CAGTTGATCCCCCAGATCTCTTCCCTGTCCTGGTTCACCACCATTGTGCCTTTGGTTCTT
GTCCTCACCATCACAGCTGTTAAAGATGCCACTGATGACTATTTCCGCCACAAGAGCGAT
AACCAGGTGAATAACCGCCAGTCTCAGGTGCTGATCAATGGAATCCTCCAGCAGGAGCAG
TGGATGAATGTCTGTGTTGGTGATATTATCAAGCTAGAAAATAACCAGTTTGTGGCGGCG
GATCTCCTCCTCCTTTCCAGCAGTGAGCCCCATGGGCTGTGTTACATAGAGACAGCAGAA
CTTGATGGCGAGACCAACATGAAAGTACGTCAGGCGATTCCAGTCACCTCAGAATTGGGA
GACATCAGTAAGCTTGCCAAGTTTGACGGTGAAGTGATCTGTGAACCTCCCAACAACAAA
CTGGACAAATTCAGCGGAACCCTCTACTGGAAGGAAAATAAGTTCCCTCTGAGCAACCAG
AACATGCTGCTGCGGGGCTGTGTGCTGCGAAACACCGAGTGGTGCTTCGGGCTGGTCATC
TTTGCAGGTCCCGACACTAAGCTGATGCAAAACAGCGGCAGAACAAAGTTCAAAAGAACG
AGTATCGATCGCCTAATGAATACCCTGGTGCTCTGGATTTTTGGATTCCTGGTTTGCATG
GGGGTGATCCTGGCCATTGGCAATGCCATCTGGGAGCACGAGGTGGGGATGCGTTTCCAG
GTCTACCTGCCGTGGGATGAGGCAGTGGACAGTGCCTTCTTCTCTGGCTTCCTCTCCTTC
TGGTCCTACATCATCATCCTCAACACCGTTGTGCCCATTTCACTCTATGTCAGTGTGGAG
GTCATCCGTCTGGGCCACAGCTACTTCATCAACTGGGATAAGAAGATGTTCTGCATGAAG
AAGCGGACGCCTGCAGAAGCCCGCACCACCACCCTAAACGAGGAGCTGGGCCAGGTGGAG
TACATCTTCTCCGACAAGACGGGCACCCTCACCCAGAACATCATGGTTTTCAACAAGTGC
TCCATCAATGGCCACAGCTATGGTGATGTGTTTGACGTCCTGGGACACAAAGCTGAATTG
GGAGAGAGGCCTGAACCTGTTGACTTCTCCTTCAATCCTCTGGCTGACAAGAAGTTCTTA
TTTTGGGACCCCAGCCTGCTGGAGGCTGTCAAGATCGGGGACCCCCACACGCATGAGTTC
TTCCGCCTCCTTTCCCTGTGTCATACTGTCATGTCAGAAGAAAAGAACGAAGGAGAGCTG
TACTACAAAGCTCAGTCCCCAGATGAGGGGGCCCTGGTCACCGCAGCCAGGAACTTTGGT
TTTGTTTTCCGCTCTCGCACCCCCAAAACAATCACCGTCCATGAGATGGGCACAGCCATC
ACCTACCAGCTGCTGGCCATCCTGGACTTCAACAACATCCGCAAGCGGATGTCGGTCATA
GTGCGGAATCCAGAGGGGAAGATCCGACTCTACTGCAAAGGGGCTGACACTATCCTACTG
GACAGACTGCACCACTCCACTCAAGAGCTGCTCAACACCACCATGGACCACCTTAATGAG
TACGCAGGGGAAGGGCTGAGGACCCTGGTGCTGGCCTACAAGGATCTGGATGAAGAGTAC
TACGAGGAGTGGGCTGAGCGACGCCTCCAGGCCAGCCTGGCCCAGGACAGCCGGGAGGAC
AGGCTGGCTAGCATCTATGAGGAGGTTGAGAACAACATGATGCTGCTGGGTGCAACGGCC
ATTGAGGACAAACTTCAGCAAGGGGTTCCAGAGACCATTGCCCTCCTGACACTGGCCAAC
ATCAAGATTTGGGTGCTAACCGGAGACAAGCAAGAGACGGCTGTGAACATCGGCTATTCC
TGCAAGATGCTGACGGATGACATGACTGAGGTTTTCATAGTCACTGGCCATACTGTCCTG
GAGGTGCGGGAGGAGCTCAGGAAAGCCCGGGAGAAGATGATGGACTCATCCCGCTCCGTA
GGCAACGGCTTCACCTATCAGGACAAGCTTTCTTCTTCCAAGCTAACTTCTGTCCTGGAG
GCCGTTGCTGGGGAGTACGCCCTGGTCATAAATGGTCACAGCCTGGCCCACGCACTGGAG
GCAGACATGGAGCTGGAGTTTCTGGAGACAGCGTGTGCCTGCAAAGCTGTCATCTGCTGC
CGGGTGACCCCCTTGCAGAAGGCACAGGTGGTAGAACTGGTCAAGAAGTACAAGAAGGCT
GTGACGCTTGCCATTGGAGACGGAGCCAATGATGTCAGCATGATCAAAACGGCTCACATT
GGTGTGGGGATCAGTGGGCAGGAAGGGATCCAGGCTGTCTTGGCCTCCGATTACTCCTTC
TCCCAGTTCAAGTTCCTGCAGCGCCTCCTGCTGGTGCATGGGCGCTGGTCCTACCTGCGA
ATGTGCAAGTTTCTTTGCTATTTCTTCTACAAAAACTTTGCTTTCACCATGGTCCACTTC
TGGTTTGGCTTCTTCTGTGGCTTCTCAGCCCAGACCGTCTATGACCAGTATTTCATCACC
CTGTATAACATCGTGTACACCTCCCTGCCAGTCCTGGCTATGGGGGTCTTTGATCAGGAT
GTCCCCGAGCAGCGGAGCATGGAGTACCCTAAGCTGTATGAGCCGGGCCAGCTGAACCTT
CTCTTCAACAAGCGGGAGTTCTTCATCTGCATCGCCCAGGGCATCTACACCTCCGTGCTC
ATGTTCTTCATTCCCTATGGGGTGTTTGCTGATGCCACCCGGGATGATGGCACTCAGCTG
GCTGACTACCAGTCCTTTGCAGTCACTGTGGCCACATCCTTGGTCATTGTGGTTAGCGTG
CAGATTGGGCTCGACACAGGCTACTGGACGGCCATCAACCACTTCTTCATCTGGGGAAGC
CTTGCTGTTTACTTTGCCATCCTCTTTGCCATGCACAGCAATGGGCTCTTCGACATGTTT
CCCAACCAGTTCCGGTTTGTGGGGAATGCCCAGAACACCTTGGCCCAGCCCACGGTGTGG
CTGACCATTGTGCTCACCACAGTCGTCTGCATCATGCCCGTGGTTGCCTTCCGATTCCTC
AGGCTCAACCTGAAGCCGGATCTCTCCGACACGGTCCGCTACACACAGCTCGTGAGGAAG
AAGCAGAAGGCCCAGCACCGCTGCATGCGGCGGGTTGGCCGCACTGGCTCCCGGCGCTCC
GGCTATGCCTTCTCCCATCAGGAGGGCTTCGGGGAGCTCATCATGTCTGGCAAGAACATG
CGGCTGAGCTCTCTCGCGCTCTCCAGCTTCACCACCCGCTCCAGCTCCAGCTGGATTGAG
AGCCTGCGCAGGAAGAAGAGTGACAGTGCCAGTAGCCCCAGTGGCGGTGCCGACAAGCCC
CTCAAGGGCTGA
Protein Properties
Number of Residues 1209
Molecular Weight 137439.1
Theoretical pI 6.99
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 65-86
  • 93-112
  • 296-317
  • 347-368
  • 890-910
  • 923-942
  • 973-994
  • 1009-1031
  • 1038-1058
  • 1079-1103
Protein Sequence
>Probable phospholipid-transporting ATPase ID
MTVPKEMPEKWARAQAPPSWSRKKPSWGTEEERRARANDREYNEKFQYASNCIKTSKYNI
LTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVPLVLVLTITAVKDATDDY
FRHKSDNQVNNRQSQVLINGILQQEQWMNVCVGDIIKLENNQFVAADLLLLSSSEPHGLC
YIETAELDGETNMKVRQAIPVTSELGDISKLAKFDGEVICEPPNNKLDKFSGTLYWKENK
FPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSIDRLMNTLVLWIF
GFLVCMGVILAIGNAIWEHEVGMRFQVYLPWDEAVDSAFFSGFLSFWSYIIILNTVVPIS
LYVSVEVIRLGHSYFINWDKKMFCMKKRTPAEARTTTLNEELGQVEYIFSDKTGTLTQNI
MVFNKCSINGHSYGDVFDVLGHKAELGERPEPVDFSFNPLADKKFLFWDPSLLEAVKIGD
PHTHEFFRLLSLCHTVMSEEKNEGELYYKAQSPDEGALVTAARNFGFVFRSRTPKTITVH
EMGTAITYQLLAILDFNNIRKRMSVIVRNPEGKIRLYCKGADTILLDRLHHSTQELLNTT
MDHLNEYAGEGLRTLVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMM
LLGATAIEDKLQQGVPETIALLTLANIKIWVLTGDKQETAVNIGYSCKMLTDDMTEVFIV
TGHTVLEVREELRKAREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAGEYALVINGHS
LAHALEADMELEFLETACACKAVICCRVTPLQKAQVVELVKKYKKAVTLAIGDGANDVSM
IKTAHIGVGISGQEGIQAVLASDYSFSQFKFLQRLLLVHGRWSYLRMCKFLCYFFYKNFA
FTMVHFWFGFFCGFSAQTVYDQYFITLYNIVYTSLPVLAMGVFDQDVPEQRSMEYPKLYE
PGQLNLLFNKREFFICIAQGIYTSVLMFFIPYGVFADATRDDGTQLADYQSFAVTVATSL
VIVVSVQIGLDTGYWTAINHFFIWGSLAVYFAILFAMHSNGLFDMFPNQFRFVGNAQNTL
AQPTVWLTIVLTTVVCIMPVVAFRFLRLNLKPDLSDTVRYTQLVRKKQKAQHRCMRRVGR
TGSRRSGYAFSHQEGFGELIMSGKNMRLSSLALSSFTTRSSSSWIESLRRKKSDSASSPS
GGADKPLKG
GenBank ID Protein 40316837
UniProtKB/Swiss-Prot ID P98198
UniProtKB/Swiss-Prot Entry Name AT8B2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC069264
GeneCard ID ATP8B2
GenAtlas ID ATP8B2
HGNC ID HGNC:13534
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]
  7. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]
  8. Harris MJ, Arias IM: FIC1, a P-type ATPase linked to cholestatic liver disease, has homologues (ATP8B2 and ATP8B3) expressed throughout the body. Biochim Biophys Acta. 2003 Jul 21;1633(2):127-31. [PubMed:12880872 ]