You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07302
Secondary Accession Numbers
  • 12924
Name Abhydrolase domain-containing protein 4
Synonyms
  1. Alpha/beta-hydrolase 4
  2. Lyso-N-acylphosphatidylethanolamine lipase
Gene Name ABHD4
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity
Specific Function Lysophospholipase selective for N-acyl phosphatidylethanolamine (NAPE). Contributes to the biosynthesis of N-acyl ethanolamines, including the endocannabinoid anandamide by hydrolyzing the sn-1 and sn-2 acyl chains from N-acyl phosphatidylethanolamine (NAPE) generating glycerophospho-N-acyl ethanolamine (GP-NAE), an intermediate for N-acyl ethanolamine biosynthesis. Hydrolyzes substrates bearing saturated, monounsaturated, polyunsaturated N-acyl chains. Shows no significant activity towards other lysophospholipids, including lysophosphatidylcholine, lysophosphatidylethanolamine and lysophosphatidylserine
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 14q11.2
SNPs ABHD4
Gene Sequence
>1029 bp
ATGGCCGATGATCTGGAGCAGCAGTCTCAAGGCTGGCTGAGTAGCTGGCTGCCCACGTGG
CGCCCCACTTCCATGTCTCAGCTGAAGAATGTGGAAGCCAGGATCCTCCAGTGTCTCCAG
AATAAGTTCCTGGCCAGATATGTATCCCTCCCAAACCAGAATAAGATCTGGACGGTGACT
GTGAGCCCCGAGCAAAACGACCGCACCCCCTTGGTGATGGTGCATGGTTTTGGGGGCGGC
GTGGGTCTCTGGATCCTCAACATGGACTCACTGAGTGCCCGCCGCACACTGCACACCTTC
GATCTGCTTGGCTTCGGGCGAAGCTCAAGGCCAGCATTCCCAAGGGACCCGGAGGGGGCT
GAGGATGAGTTTGTGACATCGATAGAGACATGGCGGGAGACCATGGGGATCCCCAGCATG
ATCCTCCTGGGGCACAGTTTGGGAGGATTCCTGGCCACTTCTTACTCAATCAAGTACCCT
GATAGAGTTAAACACCTCATCCTGGTGGACCCATGGGGCTTTCCCCTCCGACCAACTAAC
CCCAGTGGGATCTGTGCACCCCCAGCCTGGGTCAAAGCCGTGGCATCTGTCCTAGGACGT
TCCAATCCATTGGCTGTTCTTCGAGTAGCTGGGCCCTGGGGGCCTGGTCTGGTGCAGCGA
TTCCGGCCGGACTTCAAACGCAAGTTTGCAGACTTCTTTGAAGATGATACCATATCAGAG
TATATTTACCACTGCAACGCACAGAATCCCAGTGGTGAGACAGCATTCAAAGCCATGATG
GAGTCCTTTGGCTGGGCCCGGCGCCCTATGCTGGAGCGAATTCACTTGATTCGAAAAGAT
GTGCCTATCACTATGATCTACGGGTCCGACACCTGGATAGATACCAGTACGGGAAAAAAG
GTGAAGATGCAGCGGCCGGATTCCTATGTCCGAGACATGGAGATTAAGGGTGCCTCCCAC
CATGTCTATGCTGACCAGCCACACATCTTCAATGCTGTGGTGGAGGAGATCTGCGACTCA
GTTGATTGA
Protein Properties
Number of Residues 342
Molecular Weight 38794.1
Theoretical pI 7.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Abhydrolase domain-containing protein 4
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVT
VSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGA
EDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTN
PSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISE
YIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKK
VKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
GenBank ID Protein 10434528
UniProtKB/Swiss-Prot ID Q8TB40
UniProtKB/Swiss-Prot Entry Name ABHD4_HUMAN
PDB IDs Not Available
GenBank Gene ID AK022878
GeneCard ID ABHD4
GenAtlas ID ABHD4
HGNC ID HGNC:20154
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]