Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07313
Secondary Accession Numbers
  • 12935
Name Lysophospholipid acyltransferase LPCAT4
Synonyms
  1. 1-AGP acyltransferase 7
  2. 1-AGPAT 7
  3. 1-acylglycerol-3-phosphate O-acyltransferase 7
  4. Acyltransferase-like 3
  5. Lysophosphatidylcholine acyltransferase 4
  6. Lysophosphatidylethanolamine acyltransferase 2
Gene Name LPCAT4
Protein Type Enzyme
Biological Properties
General Function Involved in acyltransferase activity
Specific Function Displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates; converts lysophosphatidylethanolamine to phosphatidylethanolamine, lysophosphatidylcholine to phosphatidycholine, 1-alkenyl-lysophatidylethanolamine to 1- alkenyl-phosphatidylethanolamine, lysophosphatidylglycerol and alkyl-lysophosphatidylcholine to phosphatidylglycerol and alkyl- phosphatidylcholine, respectively. In contrast, has no lysophosphatidylinositol, glycerol-3-phosphate, diacylglycerol or lysophosphatidic acid acyltransferase activity. Prefers long chain acyl-CoAs (C16, C18) as acyl donors
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
Process
metabolic process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 15q14
SNPs LPCAT4
Gene Sequence
>1575 bp
ATGAGCCAGGGAAGTCCGGGGGACTGGGCCCCCCTAGATCCCACCCCCGGACCCCCAGCA
TCCCCCAACCCCTTCGTGCATGAGTTACATCTCTCTCGCCTCCAGAGGGTTAAGTTCTGC
CTCCTGGGGGCATTGCTGGCCCCCATCCGAGTGCTTCTGGCCTTTATCGTCCTCTTTCTC
CTCTGGCCCTTTGCCTGGCTTCAAGTGGCCGGTCTTAGTGAGGAGCAGCTTCAGGAGCCA
ATTACAGGATGGAGGAAGACTGTGTGCCACAACGGGGTGCTAGGCCTGAGCCGCCTGCTG
TTTTTCCTGCTGGGCTTCCTCCGGATTCGCGTTCGTGGCCAGCGAGCCTCTCGCCTTCAA
GCCCCTGTCCTTGTTGCTGCCCCACACTCCACTTTCTTTGACCCCATTGTTCTGCTGCCC
TGTGACCTGCCCAAAGTTGTGTCCCGAGCTGAGAACCTTTCCGTTCCTGTCATTGGAGCC
CTTCTTCGATTCAACCAAGCCATCCTGGTATCCCGGCATGACCCGGCTTCTCGACGCAGA
GTGGTGGAGGAGGTCCGAAGGCGGGCCACCTCAGGAGGCAAGTGGCCGCAGGTGCTATTC
TTTCCTGAGGGCACCTGTTCCAACAAGAAGGCTTTGCTTAAGTTCAAACCAGGAGCCTTC
ATCGCAGGGGTGCCTGTGCAGCCTGTCCTCATCCGCTACCCCAACAGTCTGGACACCACC
AGCTGGGCATGGAGGGGTCCTGGAGTACTCAAAGTCCTCTGGCTCACAGCCTCTCAGCCC
TGCAGCATTGTGGATGTGGAGTTCCTTCCTGTGTATCACCCCAGCCCTGAGGAGAGCAGG
GACCCCACCCTCTATGCCAACAATGTTCAGAGGGTCATGGCACAGGCTCTGGGCATTCCA
GCCACCGAATGTGAGTTTGTAGGGAGCTTACCTGTGATTGTGGTGGGCCGGCTGAAGGTG
GCGTTGGAACCACAGCTCTGGGAACTGGGAAAAGTGCTTCGGAAGGCTGGGCTGTCCGCT
GGCTATGTGGACGCTGGGGCAGAGCCAGGCCGGAGTCGAATGATCAGCCAGGAAGAGTTT
GCCAGGCAGCTACAGCTCTCTGATCCTCAGACGGTGGCTGGTGCCTTTGGCTACTTCCAG
CAGGATACCAAGGGTTTGGTGGACTTCCGAGATGTGGCCCTTGCACTAGCAGCTCTGGAT
GGGGGCAGGAGCCTGGAAGAGCTAACTCGTCTGGCCTTTGAGCTCTTTGCTGAAGAGCAA
GCAGAGGGTCCCAACCGCCTGCTGTACAAAGACGGCTTCAGCACCATCCTGCACCTGCTG
CTGGGTTCACCCCACCCTGCTGCCACAGCTTTGCATGCTGAGCTGTGCCAGGCAGGATCC
AGCCAAGGCCTCTCCCTCTGTCAGTTCCAGAACTTCTCCCTCCATGACCCACTCTATGGG
AAACTCTTCAGCACCTACCTGCGCCCCCCACACACCTCTCGAGGCACCTCCCAGACACCA
AATGCCTCATCCCCAGGCAACCCCACTGCTCTGGCCAATGGGACTGTGCAAGCACCCAAG
CAGAAGGGAGACTGA
Protein Properties
Number of Residues 524
Molecular Weight 57218.6
Theoretical pI 9.24
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 40-62
  • 87-107
Protein Sequence
>Lysophospholipid acyltransferase LPCAT4
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEF
ARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYG
KLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
GenBank ID Protein 87116681
UniProtKB/Swiss-Prot ID Q643R3
UniProtKB/Swiss-Prot Entry Name LPCT4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_153613.2
GeneCard ID LPCAT4
GenAtlas ID LPCAT4
HGNC ID HGNC:30059
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Ye GM, Chen C, Huang S, Han DD, Guo JH, Wan B, Yu L: Cloning and characterization a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase gene AGPAT7. DNA Seq. 2005 Oct;16(5):386-90. [PubMed:16243729 ]
  4. Cao J, Shan D, Revett T, Li D, Wu L, Liu W, Tobin JF, Gimeno RE: Molecular identification of a novel mammalian brain isoform of acyl-CoA:lysophospholipid acyltransferase with prominent ethanolamine lysophospholipid acylating activity, LPEAT2. J Biol Chem. 2008 Jul 4;283(27):19049-57. doi: 10.1074/jbc.M800364200. Epub 2008 May 5. [PubMed:18458083 ]