You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07317
Secondary Accession Numbers
  • 12939
Name Lipase member H
Synonyms
  1. LPD lipase-related protein
  2. Membrane-associated phosphatidic acid-selective phospholipase A1-alpha
  3. Phospholipase A1 member B
  4. mPA-PLA1 alpha
Gene Name LIPH
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Hydrolyzes specifically phosphatidic acid (PA) to produce lysophosphatidic acid (LPA)
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Cellular Location
  1. Peripheral membrane protein
  2. Secreted
  3. Membrane
Gene Properties
Chromosome Location Chromosome:3
Locus 3q27
SNPs LIPH
Gene Sequence
>1356 bp
ATGTTGAGATTCTACTTATTCATCAGTTTGTTGTGCTTGTCAAGATCAGACGCAGAAGAA
ACATGTCCTTCATTCACCAGGCTGAGCTTTCACAGTGCAGTGGTTGGTACGGGACTAAAT
GTGAGGCTGATGCTCTACACAAGGAAAAACCTGACCTGCGCACAAACCATCAACTCCTCA
GCTTTTGGGAACTTGAATGTGACCAAGAAAACCACCTTCATTGTCCATGGATTCAGGCCA
ACAGGCTCCCCTCCTGTTTGGATGGATGACTTAGTAAAGGGTTTGCTCTCTGTTGAAGAC
ATGAACGTAGTTGTTGTTGATTGGAATCGAGGAGCTACAACTTTAATATATACCCATGCC
TCTAGTAAGACCAGAAAAGTAGCCATGGTCTTGAAGGAATTTATTGACCAGATGTTGGCA
GAAGGAGCTTCTCTTGATGACATTTACATGATCGGAGTAAGTCTAGGAGCCCACATATCT
GGGTTTGTTGGAGAGATGTACGATGGATGGCTGGGGAGAATTACAGGCCTCGACCCTGCA
GGCCCTTTATTCAACGGGAAACCTCACCAAGACAGATTAGATCCCAGTGATGCGCAGTTT
GTTGATGTCATCCATTCCGACACTGATGCACTGGGCTACAAGGAGCCATTAGGAAACATA
GACTTCTACCCAAATGGAGGATTGGATCAACCTGGCTGCCCCAAAACAATATTGGGAGGA
TTTCAGTATTTTAAATGTGACCACCAGAGGTCTGTATACCTGTACCTGTCTTCCCTGAGA
GAGAGCTGCACCATCACTGCGTATCCCTGTGACTCCTACCAGGATTATAGGAATGGCAAG
TGTGTCAGCTGCGGCACGTCACAAAAAGAGTCCTGTCCCCTTCTGGGCTATTATGCTGAT
AATTGGAAAGACCATCTAAGGGGGAAAGATCCTCCAATGACGAAGGCATTCTTTGACACA
GCTGAGGAGAGCCCATTCTGCATGTATCATTACTTTGTGGATATTATAACATGGAACAAG
AATGTAAGAAGAGGGGACATTACCATCAAATTGAGAGACAAAGCTGGAAACACCACAGAA
TCCAAAATCAATCATGAACCCACCACATTTCAGAAATATCACCAAGTGAGTCTACTTGCA
AGATTTAATCAAGATCTGGATAAAGTGGCTGCAATTTCCTTGATGTTCTCTACAGGATCT
CTAATAGGCCCAAGGTACAAGCTCAGGATTCTCCGAATGAAGTTAAGGTCCCTTGCCCAT
CCGGAGAGGCCTCAGCTGTGTCGGTATGATCTTGTCCTGATGGAAAACGTTGAAACAGTC
TTCCAACCTATTCTTTGCCCAGAGTTGCAGTTGTAA
Protein Properties
Number of Residues 451
Molecular Weight 50858.9
Theoretical pI 7.46
Pfam Domain Function
Signals
  • 1-18
Transmembrane Regions
  • None
Protein Sequence
>Lipase member H
MLRFYLFISLLCLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSS
AFGNLNVTKKTTFIVHGFRPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHA
SSKTRKVAMVLKEFIDQMLAEGASLDDIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPA
GPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGG
FQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYAD
NWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKNVRRGDITIKLRDKAGNTTE
SKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAH
PERPQLCRYDLVLMENVETVFQPILCPELQL
GenBank ID Protein 21245106
UniProtKB/Swiss-Prot ID Q8WWY8
UniProtKB/Swiss-Prot Entry Name LIPH_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_139248.2
GeneCard ID LIPH
GenAtlas ID LIPH
HGNC ID HGNC:18483
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sonoda H, Aoki J, Hiramatsu T, Ishida M, Bandoh K, Nagai Y, Taguchi R, Inoue K, Arai H: A novel phosphatidic acid-selective phospholipase A1 that produces lysophosphatidic acid. J Biol Chem. 2002 Sep 13;277(37):34254-63. Epub 2002 Jun 12. [PubMed:12063250 ]
  4. Jin W, Broedl UC, Monajemi H, Glick JM, Rader DJ: Lipase H, a new member of the triglyceride lipase family synthesized by the intestine. Genomics. 2002 Sep;80(3):268-73. [PubMed:12213196 ]
  5. Kazantseva A, Goltsov A, Zinchenko R, Grigorenko AP, Abrukova AV, Moliaka YK, Kirillov AG, Guo Z, Lyle S, Ginter EK, Rogaev EI: Human hair growth deficiency is linked to a genetic defect in the phospholipase gene LIPH. Science. 2006 Nov 10;314(5801):982-5. [PubMed:17095700 ]
  6. Wen XY, Hegele RA, Wang J, Wang DY, Cheung J, Wilson M, Yahyapour M, Bai Y, Zhuang L, Skaug J, Young TK, Connelly PW, Koop BF, Tsui LC, Stewart AK: Identification of a novel lipase gene mutated in lpd mice with hypertriglyceridemia and associated with dyslipidemia in humans. Hum Mol Genet. 2003 May 15;12(10):1131-43. [PubMed:12719377 ]
  7. Hiramatsu T, Sonoda H, Takanezawa Y, Morikawa R, Ishida M, Kasahara K, Sanai Y, Taguchi R, Aoki J, Arai H: Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta. J Biol Chem. 2003 Dec 5;278(49):49438-47. Epub 2003 Sep 8. [PubMed:12963729 ]
  8. Naz G, Khan B, Ali G, Azeem Z, Wali A, Ansar M, Ahmad W: Novel missense mutations in lipase H (LIPH) gene causing autosomal recessive hypotrichosis (LAH2). J Dermatol Sci. 2009 Apr;54(1):12-6. doi: 10.1016/j.jdermsci.2008.12.001. Epub 2009 Jan 23. [PubMed:19167195 ]
  9. Shimomura Y, Wajid M, Petukhova L, Shapiro L, Christiano AM: Mutations in the lipase H gene underlie autosomal recessive woolly hair/hypotrichosis. J Invest Dermatol. 2009 Mar;129(3):622-8. doi: 10.1038/jid.2008.290. Epub 2008 Oct 2. [PubMed:18830268 ]