You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07323
Secondary Accession Numbers
  • 12945
Name Phosphatidate phosphatase PPAPDC1A
Synonyms
  1. Phosphatidic acid phosphatase type 2 domain-containing protein 1A
Gene Name PPAPDC1A
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.
Pathways Not Available
Reactions
A 1,2-diacylglycerol 3-phosphate + Water → a 1,2-diacyl-sn-glycerol + Phosphate details
GO Classification
Biological Process
phospholipid dephosphorylation
Cellular Component
integral to membrane
Component
membrane
cell part
Function
catalytic activity
Molecular Function
phosphatidate phosphatase activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 10
Locus 10q26.12
SNPs PPAPDC1A
Gene Sequence
>816 bp
ATGCGGGAGCTGGCCATTGAGATCGGGGTGCGAGCCCTGCTCTTCGGAGTCTTCGTTTTT
ACAGAGTTTTTGGATCCGTTCCAGAGAGTCATCCAGCCAGAAGAGATCTGGCTCTATAAA
AATCCTTTGGTGCAATCAGATAACATACCTACCCGCCTCATGTTTGCAATTTCTTTCCTC
ACACCCCTGGCTGTTATTTGTGTGGTGAAAATTATCCGGCGAACAGACAAGACTGAAATT
AAGGAAGCCTTCTTAGCGGTGTCCTTGGCTCTTGCTTTGAATGGAGTCTGCACAAACACT
ATTAAATTAATAGTGGGAAGACCTCGCCCCGATTTCTTTTACCGCTGCTTTCCAGATGGA
GTGATGAACTCGGAAATGCATTGCACAGGTGACCCCGATCTGGTGTCCGAGGGCCGCAAA
AGCTTCCCCAGCATCCATTCCTCCTTTGCCTTTTCGGGCCTTGGCTTCACGACGTTCTAC
TTGGCGGGCAAGCTGCACTGCTTCACCGAGAGTGGGCGGGGAAAGAGCTGGCGGCTCTGT
GCTGCCATCCTGCCCTTGTACTGCGCCATGATGATTGCCCTGTCCCGCATGTGCGACTAC
AAGCATCACTGGCAAGATTCCTTTGTGGGTGGAGTCATCGGCCTCATTTTTGCATACATT
TGCTACAGACAGCACTATCCTCCTCTGGCCAACACAGCTTGCCATAAACCCTACGTTAGT
CTGCGAGTCCCAGCCTCACTGAAGAAAGAGGAGAGGCCCACAGCTGACAGCGCACCCAGC
TTGCCTCTGGAGGGGATCACCGAAGGCCCGGTATGA
Protein Properties
Number of Residues 271
Molecular Weight 30394.27
Theoretical pI 8.179
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphatidate phosphatase PPAPDC1A
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL
TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG
VMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC
AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS
LRVPASLKKEERPTADSAPSLPLEGITEGPV
GenBank ID Protein 73611920
UniProtKB/Swiss-Prot ID Q5VZY2
UniProtKB/Swiss-Prot Entry Name PPC1A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001030059.1
GeneCard ID PPAPDC1A
GenAtlas ID PPAPDC1A
HGNC ID HGNC:23531
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Takeuchi M, Harigai M, Momohara S, Ball E, Abe J, Furuichi K, Kamatani N: Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase. Gene. 2007 Sep 15;399(2):174-80. Epub 2007 Jun 2. [PubMed:17590538 ]