You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07325
Secondary Accession Numbers
  • 12947
Name GPI mannosyltransferase 3
Synonyms
  1. GPI mannosyltransferase III
  2. GPI-MT-III
  3. PIG-B
  4. Phosphatidylinositol-glycan biosynthesis class B protein
Gene Name PIGB
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring glycosyl groups
Specific Function Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the third alpha-1,2-mannose to Man2-GlcN-acyl-PI during GPI precursor assembly
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
intrinsic to organelle membrane
intrinsic to endoplasmic reticulum membrane
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
metabolic process
macromolecule metabolic process
protein amino acid lipidation
gpi anchor biosynthetic process
macromolecule modification
protein modification process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 15q21-q22
SNPs PIGB
Gene Sequence
>1665 bp
ATGAGGAGGCCCCTAAGCAAGTGCGGAATGGAGCCGGGGGGCGGAGATGCCAGCCTCACT
TTGCATGGTCTCCAGAACCGCTCCCACGGCAAGATAAAGCTGCGAAAGAGAAAGTCTACC
TTGTACTTCAACACCCAGGAGAAGAGCGCCAGGCGCCGCGGGGATCTTCTTGGAGAAAAT
ATTTATCTGCTCTTGTTTACCATAGCTTTACGAATATTAAACTGCTTTTTAGTGCAGACA
AGTTTTGTTCCAGATGAATACTGGCAGTCTCTTGAAGTTTCACATCACATGGTTTTCAAT
TATGGTTATTTGACTTGGGAATGGACAGAGAGACTGAGGAGTTACACTTATCCCTTAATC
TTTGCAAGCATTTACAAGATTCTTCATCTTTTAGGGAAAGATAGTGTTCAGTTGCTGATT
TGGATTCCTAGACTTGCCCAAGCACTTCTGTCTGCTGTAGCAGATGTGAGACTTTACTCA
TTAATGAAGCAACTAGAAAATCAGGAAGTGGCAAGATGGGTGTTTTTTTGCCAGTTGTGC
TCCTGGTTCACATGGTATTGCTGTACCAGAACCCTTACAAACACCATGGAAATTGTTCTC
ACTATAATTGCTCTTTTCTACTATCCTTTGGAAGGTTCAAAGTCTATGAACAGTGTCAAA
TACTCATCCCTGGTGGCACTTGCCTTCATAATTCGTCCCACAGCTGTCATTCTGTGGACA
CCTTTGCTCTTCAGACATTTCTGTCAAGAACCAAGAAAGCTTGATCTTATTCTACATCAT
TTTTTACCTGTAGGCTTTGTTACTTTGAGTTTGTCTCTGATGATTGATCGTATTTTTTTT
GGCCAATGGACTCTGGTTCAATTTAATTTTTTGAAATTTAACGTGCTGCAGAACTTGGGA
ACATTTTATGGTTCTCATCCATGGCACTGGTACTTCAGTCAAGGATTTCCAGTTATCTTG
GGTACTCACTTACCCTTCTTTATTCATGGCTGCTATCTAGCACCAAAGAGATACCGGATA
CTTTTGGTGACTGTGCTGTGGACACTGCTTGTTTATAGCATGTTGAGCCACAAAGAATTC
AGGTTTATTTATCCAGTTTTACCATTCTGTATGGTGTTCTGTGGATACTCATTAACCCAC
CTGAAAACATGGAAGAAACCAGCTCTAAGTTTCCTGTTTTTATCAAATTTGTTCCTCGCC
CTTTATACTGGTTTAGTTCATCAACGAGGTACTCTTGATGTCATGAGTCATATTCAAAAA
GTTTGTTACAACAATCCCAATAAATCTTCAGCTTCAATATTTATAATGATGCCTTGCCAC
TCTACTCCTTATTACAGCCATGTTCACTGCCCACTTCCCATGAGATTTCTCCAGTGCCCG
CCAGACCTGACTGGAAAAAGTCATTATCTTGATGAAGCAGATGTATTTTACCTAAATCCC
TTAAACTGGTTACATAGAGAGTTTCATGATGATGCATCATTGCCTACTCACTTGATCACC
TTCAGCATTTTGGAAGAGGAAATAAGCGCTTTCCTAATTTCAAGCAATTATAAAAGAACT
GCTGTTTTCTTCCACACTCACTTGCCAGAGGGTCGAATTGGAAGTCACATATATGTCTAT
GAACGGAAGTTAAAAGGGAAATTCAACATGAAGATGAAATTCTGA
Protein Properties
Number of Residues 554
Molecular Weight 65055.9
Theoretical pI 9.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 63-83
  • 136-156
  • 192-212
  • 224-244
  • 255-275
  • 315-335
  • 340-360
  • 362-382
  • 387-407
Protein Sequence
>GPI mannosyltransferase 3
MRRPLSKCGMEPGGGDASLTLHGLQNRSHGKIKLRKRKSTLYFNTQEKSARRRGDLLGEN
IYLLLFTIALRILNCFLVQTSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLI
FASIYKILHLLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLENQEVARWVFFCQLC
SWFTWYCCTRTLTNTMETVLTIIALFYYPLEGSKSMNSVKYSSLVALAFIIRPTAVILWT
PLLFRHFCQEPRKLDLILHHFLPVGFVTLSLSLMIDRIFFGQWTLVQFNFLKFNVLQNWG
TFYGSHPWHWYFSQGFPVILGTHLPFFIHGCYLAPKRYRILLVTVLWTLLVYSMLSHKEF
RFIYPVLPFCMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQK
VCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEADVFYLNP
LNWLHREFHDDASLPTHLITFSILEEEISAFLISSNYKRTAVFFHTHLPEGRIGSHIYVY
ERKLKGKFNMKMKF
GenBank ID Protein 62898221
UniProtKB/Swiss-Prot ID Q92521
UniProtKB/Swiss-Prot Entry Name PIGB_HUMAN
PDB IDs Not Available
GenBank Gene ID AK223330
GeneCard ID PIGB
GenAtlas ID PIGB
HGNC ID HGNC:8959
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Takahashi M, Inoue N, Ohishi K, Maeda Y, Nakamura N, Endo Y, Fujita T, Takeda J, Kinoshita T: PIG-B, a membrane protein of the endoplasmic reticulum with a large lumenal domain, is involved in transferring the third mannose of the GPI anchor. EMBO J. 1996 Aug 15;15(16):4254-61. [PubMed:8861954 ]
  3. Mohney RP, Knez JJ, Ravi L, Sevlever D, Rosenberry TL, Hirose S, Medof ME: Glycoinositol phospholipid anchor-defective K562 mutants with biochemical lesions distinct from those in Thy-1- murine lymphoma mutants. J Biol Chem. 1994 Mar 4;269(9):6536-42. [PubMed:7907094 ]