You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07328
Secondary Accession Numbers
  • 12950
Name GPI ethanolamine phosphate transferase 1
Synonyms
  1. MCD4 homolog
  2. PIG-N
  3. Phosphatidylinositol-glycan biosynthesis class N protein
Gene Name PIGN
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers ethanolamine phosphate to the first alpha-1,4-linked mannose of the glycosylphosphatidylinositol precursor of GPI-anchor
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
endoplasmic reticulum membrane
organelle membrane
Function
catalytic activity
transferase activity
Process
metabolic process
macromolecule metabolic process
protein amino acid lipidation
gpi anchor biosynthetic process
macromolecule modification
protein modification process
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 18q21.33
SNPs PIGN
Gene Sequence
>2796 bp
ATGCTGCTGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTT
GACATTTATTTTACATCTCCTTTGGTTCATGGAATGACTCCTCAGTTTACACCATTGCCT
CCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTAC
GAATTAGATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAA
GGCAGCTGGGGCATATCTCATACACGTGTGCCAACAGAATCTCGGCCAGGTCATGTAGCT
CTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCT
GTAGAGTTTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGAT
ATCCTGCCTATGTTTGCCAAAGGTGCTAGTGGAGACCACGTTTATACATATAGTTATGAT
GCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGAT
AATGTTAAGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAAT
GAAGAGAAAATAGTTTTTTTCTTACATTTATTAGGAATAGATACAAACGGACATGCTCAT
CGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAA
ATCGTGTCTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACC
TCTGACCATGGAATGACAGACTGGGGTTCCCATGGGGCTGGTCATCCTTCAGAGACTTTA
ACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAA
TTTGATGATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAAT
CAGGCTGATATTGCACCATTGATGACTTCCCTTATTGGAGTTCCCTTTCCTCTTAACTCA
GTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATG
TTTACAAATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAA
GTTACTTTACCATTTTTGTTTACACCATTTAAACTGCTTTCTGATTCCAAACAGTTCAAC
ATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTT
TGCAAGGAGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGA
TTCTTTTTGGGCGTCAATGTTGTTATTGGTTTTGTGGGATGGATATCTTATGCCTCTTTG
TTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCA
AGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTG
ATTCAAGCCTGTCCCTGGACATATTATGTATATGGTTTGTTGCCACTGCCAATATGGTAT
GCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCT
CTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTC
AGTTTTTTCTACCGCTATATGCTTACCGCTGGACTTACTGCCTTTGCAGCTTGGCCATTT
CTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTG
CTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTG
ATGGGTGCAGGCTTGCTGGTTCTTCTGTTATCCCTGTGTGTTGTAACATCTCTCATGAAA
AGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACA
GTGCTCTCCATGTATGTTGTGTATAGCACTCAGAGTAGTTTACTCAGGAAGCAAGGACTG
CCTCTCATGAATCAAATTATTAGCTGGGCAACATTAGCCTCTTCCTTGGTTGTGCCACTA
CTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACC
TACCTACTTCTAAGCACAGGGTATGAAGCTCTCTTTCCACTAGTGTTGTCTTGTTTGATG
TTTGTCTGGATAAACATAGAACAAGAAACTCTACAACAATCTGGTGTTTGCTGTAAACAA
AAGCTCACCAGTATCCAGTTCTCTTATAATACTGATATAACTCAGTTTCGACAGCTATAT
CTGGATGACATCCGTAGGGCCTTTTTCCTTGTTTTCTTCTTAGTGACAGCATTTTTTGGA
ACTGGAAATATAGCTTCTATTAACAGCTTTGATCTTGCCTCTGTCTATTGCTTTCTGACT
GTGTTCAGTCCTTTTATGATGGGAGCCCTGATGATGTGGAAGATTTTAATCCCCTTTGTT
CTTGTTATGTGTGCTTTTGAAGCAGTTCAGTTGACTACTCAGTTATCGTCAAAAAGCCTT
TTTCTCATTGTTCTCGTCATATCAGACATTATGGCTTTGCATTTTTTCTTCTTGGTCAAG
GATTATGGCAGCTGGCTTGATATTGGGACAAGCATCAGCCACTATGTGATTGTCATGTCC
ATGACCATCTTTTTGGTGTTCCTCAATGGCCTGGCCCAGCTGCTCACAACGAAGAAACTC
AGACTATGTGGCAAACCCAAAAGTCACTTCATGTGA
Protein Properties
Number of Residues 931
Molecular Weight 105809.2
Theoretical pI 8.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 2-24
  • 443-463
  • 483-503
  • 509-529
  • 544-564
  • 566-586
  • 592-612
  • 619-639
  • 650-670
  • 686-706
  • 724-744
  • 787-807
  • 825-845
  • 859-879
  • 895-915
Protein Sequence
>GPI ethanolamine phosphate transferase 1
MLLFFTLGLLIHFVFFASIFDIYFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADALY
ELDENGNSRAPFIRNIIMHEGSWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENP
VEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTWVFD
NVKDFFHHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKHNIKKVDDGVKE
IVSMFNHFYGNDGKTTFIFTSDHGMTDWGSHGAGHPSETLTPLVTWGAGIKYPQRVSAQQ
FDDAFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDYLNNTDLFKAESM
FTNAVQILEQFKVKMTQKKEVTLPFLFTPFKLLSDSKQFNILRKARSYIKHRKFDEVVSL
CKELIHLALKGLSYYHTYDRFFLGVNVVIGFVGWISYASLLIIKSHSNLIKGVSKEVKKP
SHLLPCSFVAIGILVAFFLLIQACPWTYYVYGLLPLPIWYAVLREFQVIQDLVVSVLTYP
LSHFVGYLLAFTLGIEVLVLSFFYRYMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSL
LLAVFPLMPVVGRKPDISLVMGAGLLVLLLSLCVVTSLMKRKDSFIKEELLVHLLQVLST
VLSMYVVYSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMST
YLLLSTGYEALFPLVLSCLMFVWINIEQETLQQSGVCCKQKLTSIQFSYNTDITQFRQLY
LDDIRRAFFLVFFLVTAFFGTGNIASINSFDLASVYCFLTVFSPFMMGALMMWKILIPFV
LVMCAFEAVQLTTQLSSKSLFLIVLVISDIMALHFFFLVKDYGSWLDIGTSISHYVIVMS
MTIFLVFLNGLAQLLTTKKLRLCGKPKSHFM
GenBank ID Protein 4206155
UniProtKB/Swiss-Prot ID O95427
UniProtKB/Swiss-Prot Entry Name PIGN_HUMAN
PDB IDs Not Available
GenBank Gene ID AF109219
GeneCard ID PIGN
GenAtlas ID PIGN
HGNC ID HGNC:8967
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Gaynor EC, Mondesert G, Grimme SJ, Reed SI, Orlean P, Emr SD: MCD4 encodes a conserved endoplasmic reticulum membrane protein essential for glycosylphosphatidylinositol anchor synthesis in yeast. Mol Biol Cell. 1999 Mar;10(3):627-48. [PubMed:10069808 ]