You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07330
Secondary Accession Numbers
  • 12952
Name GPI transamidase component PIG-S
Synonyms
  1. Phosphatidylinositol-glycan biosynthesis class S protein
Gene Name PIGS
Protein Type Enzyme
Biological Properties
General Function Involved in protein binding
Specific Function Component of the GPI transamidase complex. Essential for transfer of GPI to proteins, particularly for formation of carbonyl intermediates
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.2
SNPs PIGS
Gene Sequence
>1668 bp
ATGGCGGCCGCCGGGGCTGCGGCTACACACCTAGAGGTGGCCCGGGGCAAGCGCGCCGCC
CTCTTCTTCGCTGCGGTGGCCATCGTGCTGGGGCTACCGCTCTGGTGGAAGACCACGGAG
ACCTACCGGGCCTCGTTGCCTTACTCCCAGATCAGTGGCCTGAATGCCCTTCAGCTCCGC
CTCATGGTGCCTGTCACTGTCGTGTTTACGCGGGAGTCAGTGCCCCTGGACGACCAGGAG
AAGCTGCCCTTCACCGTTGTGCATGAAAGAGAGATTCCTCTGAAATACAAAATGAAAATC
AAATGCCGTTTCCAGAAGGCCTATCGGAGGGCTTTGGACCATGAGGAGGAGGCCCTGTCA
TCGGGCAGTGTGCAAGAGGCAGAAGCCATGTTAGATGAGCCTCAGGAACAAGCGGAGGGC
TCCCTGACTGTGTACGTGATATCTGAACACTCCTCACTTCTTCCCCAGGACATGATGAGC
TACATTGGGCCCAAGAGGACAGCAGTGGTGCGGGGGATAATGCACCGGGAGGCCTTTAAC
ATCATTGGCCGCCGCATAGTCCAGGTGGCCCAGGCCATGTCTTTGACTGAGGATGTGCTT
GCTGCTGCTCTGGCTGACCACCTTCCAGAGGACAAGTGGAGCGCTGAGAAGAGGCGGCCT
CTCAAGTCCAGCTTGGGCTATGAGATCACCTTCAGTTTACTCAACCCAGACCCCAAGTCC
CATGATGTCTACTGGGACATTGAGGGGGCTGTCCGGCGCTATGTGCAACCTTTCCTGAAT
GCCCTCGGTGCCGCTGGCAACTTCTCTGTGGACTCTCAGATTCTTTACTATGCAATGTTG
GGGGTGAATCCCCGCTTTGACTCAGCTTCCTCCAGCTACTATTTGGACATGCACAGCCTC
CCCCATGTCATCAACCCAGTGGAGTCCCGGCTGGGATCCAGTGCTGCCTCCTTGTACCCT
GTGCTCAACTTTCTACTCTACGTGCCTGAGCTTGCACACTCACCGCTGTACATTCAGGAC
AAGGATGGCGCTCCAGTGGCCACCAATGCCTTCCATAGTCCCCGCTGGGGTGGCATTATG
GTATATAATGTTGACTCCAAAACCTATAATGCCTCAGTGCTGCCAGTGAGAGTCGAGGTG
GACATGGTGCGAGTGATGGAGGTGTTCCTGGCACAGTTGCGGTTGCTCTTTGGGATTGCT
CAGCCCCAGCTGCCTCCAAAATGCCTGCTTTCAGGGCCTACGAGTGAAGGGCTAATGACC
TGGGAGCTAGACCGGCTGCTCTGGGCTCGGTCAGTGGAGAACCTGGCCACAGCCACCACC
ACCCTTACCTCCCTGGCGCAGCTTCTGGGCAAGATCAGCAACATTGTCATTAAGGACGAC
GTGGCATCTGAGGTGTACAAGGCTGTAGCTGCCGTCCAGAAGTCGGCAGAAGAGTTGGCG
TCTGGGCACCTGGCATCTGCCTTTGTCGCCAGCCAGGAAGCTGTGACATCCTCTGAGCTT
GCCTTCTTTGACCCGTCACTCCTCCACCTCCTTTATTTCCCTGATGACCAGAAGTTTGCC
ATCTACATCCCACTCTTCCTGCCTATGGCTGTGCCCATCCTCCTGTCCCTGGTCAAGATC
TTCCTGGAGACCCGCAAGTCCTGGAGAAAGCCTGAGAAGACAGACTGA
Protein Properties
Number of Residues 555
Molecular Weight 61655.5
Theoretical pI 6.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 19-39
  • 521-541
Protein Sequence
>GPI transamidase component PIG-S
MAAAGAAATHLEVARGKRAALFFAAVAIVLGLPLWWKTTETYRASLPYSQISGLNALQLR
LMVPVTVVFTRESVPLDDQEKLPFTVVHEREIPLKYKMKIKCRFQKAYRRALDHEEEALS
SGSVQEAEAMLDEPQEQAEGSLTVYVISEHSSLLPQDMMSYIGPKRTAVVRGIMHREAFN
IIGRRIVQVAQAMSLTEDVLAAALADHLPEDKWSAEKRRPLKSSLGYEITFSLLNPDPKS
HDVYWDIEGAVRRYVQPFLNALGAAGNFSVDSQILYYAMLGVNPRFDSASSSYYLDMHSL
PHVINPVESRLGSSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIM
VYNVDSKTYNASVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMT
WELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELA
SGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLVKI
FLETRKSWRKPEKTD
GenBank ID Protein 14456613
UniProtKB/Swiss-Prot ID Q96S52
UniProtKB/Swiss-Prot Entry Name PIGS_HUMAN
PDB IDs Not Available
GenBank Gene ID AB057723
GeneCard ID PIGS
GenAtlas ID PIGS
HGNC ID HGNC:14937
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  4. Ohishi K, Inoue N, Kinoshita T: PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8. EMBO J. 2001 Aug 1;20(15):4088-98. [PubMed:11483512 ]