You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07335
Secondary Accession Numbers
  • 12957
Name Cytoplasmic phosphatidylinositol transfer protein 1
Synonyms
  1. M-rdgB beta
  2. Mammalian rdgB homolog beta
  3. MrdgBbeta
  4. RdgBbeta
  5. Retinal degeneration B homolog beta
Gene Name PITPNC1
Protein Type Unknown
Biological Properties
General Function Involved in transport
Specific Function Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24.2
SNPs PITPNC1
Gene Sequence
>999 bp
ATGCTGCTGAAAGAGTACCGGATCTGCATGCCGCTCACCGTAGACGAGTACAAAATTGGA
CAGCTGTACATGATCAGCAAACACAGCCATGAACAGAGTGACCGGGGAGAAGGGGTGGAG
GTCGTCCAGAATGAGCCCTTTGAGGACCCTCACCATGGCAATGGGCAGTTCACCGAGAAG
CGGGTGTATCTCAACAGCAAACTGCCTAGTTGGGCTAGAGCTGTTGTCCCCAAAATATTT
TATGTGACAGAGAAGGCTTGGAACTATTATCCCTACACAATTACAGAATACACATGTTCC
TTTCTGCCGAAATTCTCCATTCATATAGAAACCAAGTATGAGGACAACAAAGGAAGCAAT
GACACCATTTTCGACAGTGAAGCCAAAGACGTGGAGAGAGAAGTTTGCTTTATTGATATT
GCCTGCGATGAAATTCCAGAGCGCTACTACAAAGAATCCGAGGATCCTAAGCACTTCAAG
TCAGAGAAGACAGGACGGGGACAGTTGAGGGAAGGCTGGAGAGATAGTCATCAGCCTATC
ATGTGCTCCTACAAGCTGGTGACTGTGAAGTCTGAGGTCTGGGGGCTTCAGACCAGAGTG
GAACAATTTGTACACAAGGTGGTCCGAGACATTCTGCTGATTGGACATAGACAGGCTTTT
GCATGGGTTGATGAGTGGTATGACATGACAATGGATGAAGTCCGAGAATTTGAACGAGCC
ACTCAGGAAGCCACCAACAAGAAAATCGGCATTTTCCCACCTGCAATTTCTATCTCCAGC
ATCCCCCTGCTGCCTTCTTCCGTCCGCAGTGCGCCTTCTAGTGCTCCATCCACCCCTCTC
TCCACAGACGCACCCGAATTTCTGTCCGTTCCCAAAGATCGGCCCCGGAAAAAGTCTGCC
CCAGAAACTCTCACACTTCCAGACCCTGAGAAAAAAGCCACCCTGAATTTACCCGGCATG
CACTCTTCAGATAAGCCATGTCGGCCCAAATCTGAGTAA
Protein Properties
Number of Residues 332
Molecular Weight 38373.2
Theoretical pI 6.36
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytoplasmic phosphatidylinositol transfer protein 1
MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEK
RVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSN
DTIFDNEAKDVEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPI
MCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDDVREFERA
TQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSA
PETLTLPDPEKKATLNLPGMHSSDKPCRPKSE
GenBank ID Protein 6272656
UniProtKB/Swiss-Prot ID Q9UKF7
UniProtKB/Swiss-Prot Entry Name PITC1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF171102
GeneCard ID PITPNC1
GenAtlas ID PITPNC1
HGNC ID HGNC:21045
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Fullwood Y, dos Santos M, Hsuan JJ: Cloning and characterization of a novel human phosphatidylinositol transfer protein, rdgBbeta. J Biol Chem. 1999 Oct 29;274(44):31553-8. [PubMed:10531358 ]