You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07337
Secondary Accession Numbers
  • 12959
Name Membrane-associated phosphatidylinositol transfer protein 2
Synonyms
  1. NIR-3
  2. PITPnm 2
  3. Phosphatidylinositol transfer protein, membrane-associated 2
  4. Pyk2 N-terminal domain-interacting receptor 3
Gene Name PITPNM2
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro). Binds calcium ions
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
Process
establishment of localization
transport
Cellular Location
  1. Endomembrane system
  2. Peripheral membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.31
SNPs PITPNM2
Gene Sequence
>4050 bp
ATGATTATAAAGGAATATCGGATTCCTCTGCCAATGACCGTGGAGGAGTACCGCATCGCC
CAGCTGTACATGATACAGAAGAAGAGCCGTAACGAGACATATGGCGAAGGCAGCGGCGTG
GAGATCCTGGAGAACCGGCCGTACACAGATGGCCCAGGCGGCTCTGGGCAGTACACACAC
AAGGTGTATCATGTGGGCATGCACATTCCCAGCTGGTTCCGCTCCATCCTGCCCAAGGCA
GCCCTGCGGGTGGTGGAGGAGTCTTGGAATGCCTACCCCTACACCCGAACCAGGTTCACC
TGTCCTTTCGTGGAGAAATTCTCCATCGACATTGAAACCTTTTATAAAACTGATGCTGGA
GAAAACCCCGACGTGTTCAACCTCTCTCCTGTGGAAAAGAACCAGCTGACAATCGACTTC
ATCGACATTGTCAAAGACCCTGTGCCCCACAACGAGTATAAGACAGAAGAGGACCCCAAG
CTGTTCCAGTCAACCAAGACCCAGCGGGGGCCCCTGTCCGAGAACTGGATCGAGGAGTAC
AAGAAGCAGGTCTTCCCCATCATGTGCGCATACAAGCTCTGCAAGGTGGAGTTCCGCTAC
TGGGGCATGCAGTCCAAGATCGAGAGGTTCATCCACGACACCGGACTACGGAGGGTGATG
GTGCGGGCTCACCGGCAGGCCTGGTGCTGGCAGGACGAGTGGTATGGGCTGAGCATGGAG
AACATCCGGGAGCTGGAGAAGGAGGCACAGCTCATGCTTTCCCGTAAGATGGCCCAGTTC
AATGAGGATGGTGAGGAGGCCACTGAGCTCGTCAAGCACGAAGCCGTCTCGGACCAGACC
TCTGGGGAGCCCCCGGAGCCCAGCAGCAGCAATGGGGAGCCCCTAGTGGGGCGCGGCCTC
AAGAAACAGTGGTCCACATCCTCCAAGTCGTCTCGGTCGTCCAAGCGGGGAGCGAGTCCT
TCCCGCCACAGCATCTCAGAGTGGAGGATGCAGAGTATTGCCAGGGACTCGGATGAGAGC
TCAGATGATGAGTTCTTCGATGCGCACGAGGACCTGTCCGACACAGAGGAAATGTTCCCC
AAGGACATCACCAAGTGGAGCTCCAATGACCTCATGGACAAGATCGAGAGCCCAGAGCCG
GAAGACACACAAGATGGTCTGTACCGCCAGGGTGCCCCTGAGTTCAGGGTGGCCTCCAGT
GTGGAGCAGCTGAACATCATAGAGGACGAGGTTAGCCAGCCGCTGGCTGCACCGCCCTCC
AAGATCCACGTGCTGCTACTGGTGCTGCACGGAGGCACCATCCTGGACACAGGCGCCGGG
GACCCCAGCTCCAAGAAGGGCGATGCTAACACCATCGCCAACGTGTTCGACACCGTCATG
CGCGTGCACTACCCCAGCGCCCTGGGCCGCCTTGCCATCCGCCTGGTGCCCTGCCCGCCC
GTCTGCTCTGACGCCTTTGCCCTGGTCTCCAACCTCAGCCCCTACAGCCATGACGAAGGC
TGTCTGTCCAGCAGTCAGGACCACATTCCCCTGGCTGCCCTCCCCCTGCTGGCCACCTCC
TCCCCCCAGTACCAGGAGGCAGTTGCCACAGTGATTCAGCGAGCCAACCTTGCCTATGGG
GACTTCATCAAGTCCCAGGAGGGCATGACCTTCAATGGGCAGGTCTGCCTGATTGGGGAC
TGCGTCGGGGGCATCCTGGCATTTGATGCCCTGTGCTACAGTAACCAGCCGGTGTCTGAG
AGTCAGAGCAGCAGCCGCCGGGGCAGCGTGGTCAGCATGCAGGACAATGACCTGCTGTCC
CCGGGCATCCTGATGAATGCAGCACACTGCTGCGGTGGTGGCGGTGGCGGCGGTGGCGGT
GGTGGCAGCAGTGGTGGTGGTGGCAGTAGTGGTGGCTCCAGCCTGGAGAGCAGTCGGCAC
CTGAGCCGAAGCAACGTCGACATCCCCCGCAGCAACGGCACTGAGGACCCCAAAAGGCAA
CTGCCCCGCAAGAGGAGCGACTCATCCACCTACGAGCTGGATACCATCCAGCAGCACCAG
GCCTTCCTGTCCAGCCTCCATGCCAGCGTGCTGAGGACTGAGCCCTGCTCACGCCATTCC
AGCAGCTCCACCATGCTGGATGGCACAGGTGCCCTGGGCAGGTTTGACTTTGAGATCACC
GACCTCTTCCTCTTCGGGTGCCCGCTGGGGCTGGTCCTGGCCTTGAGGAAGACTGTCATC
CCAGCCCTGGATGTTTTCCAGCTGCGGCCGGCCTGCCAGCAAGTCTACAACCTCTTCCAC
CCCGCGGACCCGTCAGCTTCACGCCTGGAGCCGCTGCTGGAACGGCGCTTTCACGCCCTG
CCGCCTTTCAGCGTCCCCCGCTACCAACGCTACCCGCTGGGGGATGGCTGCTCCACGCTG
CTGGCGGATGTGCTCCAGACCCACAATGCAGCCTTCCAAGAGCATGGCGCCCCCTCCTCG
CCGGGCACTGCCCCTGCCAGTCGTGGCTTCCGCCGAGCCAGTGAGATCAGCATCGCCAGC
CAGGTGTCAGGCATGGCTGAGAGCTACACGGCATCCAGCATCGCCCAGAAGGCCCCCGAT
GCGCTCAGCCATACCCCCAGCGTCAGGCGTCTGTCCCTGCTCGCCCTGCCCGCCCCCAGC
CCCACCACCCCTGGCCCCCACCCTCCAGCCAGGAAGGCAAGCCCTGGCCTGGAGAGGGCC
CCTGGCCTCCCTGAGCTGGACATTGGAGAAGTCGCTGCAAAGTGGTGGGGCCAGAAGCGG
ATCGACTACGCCCTGTACTGCCCTGACGCCCTCACGGCCTTCCCCACGGTGGCTCTGCCT
CACCTCTTCCACGCCAGCTACTGGGAGTCAACAGACGTGGTCTCCTTTCTGCTGAGACAG
GTCATGAGGCATGACAACTCCAGCATCTTGGAGCTGGATGGCAAGGAAGTGTCGGTGTTC
ACCCCCTCAAAGCCAAGGGAGAAGTGGCAGCGCAAGCGGACCCACGTGAAGCTGCGGAAC
GTGACGGCCAACCACCGGATCAATGATGCCCTTGCCAATGAGGACGGCCCCCAGGTTCTG
ACGGGCAGGTTCATGTATGGGCCCCTGGACATGGTCACCCTGACTGGGGAGAAGGTGGAT
GTGCACATCATGACCCAGCCGCCCTCAGGCGAGTGGCTCTACCTGGATACGCTGGTGACC
AACAACAGTGGGCGTGTCTCCTACACCATCCCTGAGTCGCACCGCCTGGGCGTGGGTGTC
TACCCTATCAAGATGGTGGTCAGGGGAGACCACACGTTTGCCGACAGCTACATCACCGTG
CTGCCCAAGGGCACAGAGTTCGTGGTCTTCAGCATCGACGGTTCCTTTGCCGCTAGCGTG
TCCATCATGGGCAGCGACCCCAAGGTGCGGGCCGGGGCCGTGGACGTGGTGCGGCACTGG
CAGGACCTGGGCTACCTCATCATCTACGTGACGGGCCGGCCCGACATGCAGAAGCAGCGG
GTGGTGGCGTGGCTGGCCCAGCACAACTTCCCCCATGGCGTGGTGTCCTTCTGTGACGGC
CTGGTGCATGACCCGCTGCGGCACAAGGCCAACTTCCTGAAGCTGCTCATCTCCGAGCTG
CACCTGCGCGTGCACGCGGCCTATGGCTCCACCAAGGACGTGGCGGTGTACAGCGCCATT
AGCCTGTCCCCCATGCAGATCTACATCGTGGGCCGGCCCACCAAGAAGCTGCAGCAGCAG
TGCCAGTTCATCACGGATGGCTACGCGGCCCACCTGGCGCAGCTGAAGTACAGCCACCGG
GCGCGGCCCGCTCGCAACACGGCCACCCGCATGGCGCTGCGCAAGGGCAGCTTCGGCCTG
CCCGGCCAGGGCGACTTTCTGCGCTCCCGGAACCACCTGCTTCGCACCATCTCGGCCCAG
CCCAGCGGGCCCAGCCACCGGCACGAGCGGACACAGAGCCAGGCGGATGGCGAGCAGCGG
GGCCAGCGCAGCATGAGTGTGGCGGCCGGCTGCTGGGGCCGCGCCATGACTGGCCGCCTG
GAGCCGGGGGCAGCCGCGGGCCCCAAGTAG
Protein Properties
Number of Residues 1349
Molecular Weight 148931.9
Theoretical pI 7.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Membrane-associated phosphatidylinositol transfer protein 2
MIIKEYRIPLPMTVEEYRIAQLYMIQKKSRNETYGEGSGVEILENRPYTDGPGGSGQYTH
KVYHVGMHIPSWFRSILPKAALRVVEESWNAYPYTRTRFTCPFVEKFSIDIETFYKTDAG
ENPDVFNLSPVEKNQLTIDFIDIVKDPVPHNEYKTEEDPKLFQSTKTQRGPLSENWIEEY
KKQVFPIMCAYKLCKVEFRYWGMQSKIERFIHDTGLRRVMVRAHRQAWCWQDEWYGLSME
NIRELEKEAQLMLSRKMAQFNEDGEEATELVKHEAVSDQTSGEPPEPSSSNGEPLVGRGL
KKQWSTSSKSSRSSKRGASPSRHSISEWRMQSIARDSDESSDDEFFDAHEDLSDTEEMFP
KDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPS
KIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPP
VCSDAFALVSNLSPYSHDEGCLSSSQDHIPLAALPLLATSSPQYQEAVATVIQRANLAYG
DFIKSQEGMTFNGQVCLIGDCVGGILAFDALCYSNQPVSESQSSSRRGSVVSMQDNDLLS
PGILMNAAHCCGGGGGGGGGGGSSGGGGSSGGSSLESSRHLSRSNVDIPRSNGTEDPKRQ
LPRKRSDSSTYELDTIQQHQAFLSSLHASVLRTEPCSRHSSSSTMLDGTGALGRFDFEIT
DLFLFGCPLGLVLALRKTVIPALDVFQLRPACQQVYNLFHPADPSASRLEPLLERRFHAL
PPFSVPRYQRYPLGDGCSTLLADVLQTHNAAFQEHGAPSSPGTAPASRGFRRASEISIAS
QVSGMAESYTASSIAQKAPDALSHTPSVRRLSLLALPAPSPTTPGPHPPARKASPGLERA
PGLPELDIGEVAAKWWGQKRIDYALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQ
VMRHDNSSILELDGKEVSVFTPSKPREKWQRKRTHVKLRNVTANHRINDALANEDGPQVL
TGRFMYGPLDMVTLTGEKVDVHIMTQPPSGEWLYLDTLVTNNSGRVSYTIPESHRLGVGV
YPIKMVVRGDHTFADSYITVLPKGTEFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHW
QDLGYLIIYVTGRPDMQKQRVVAWLAQHNFPHGVVSFCDGLVHDPLRHKANFLKLLISEL
HLRVHAAYGSTKDVAVYSAISLSPMQIYIVGRPTKKLQQQCQFITDGYAAHLAQLKYSHR
ARPARNTATRMALRKGSFGLPGQGDFLRSRNHLLRTISAQPSGPSHRHERTQSQADGEQR
GQRSMSVAAGCWGRAMTGRLEPGAAAGPK
GenBank ID Protein 24308237
UniProtKB/Swiss-Prot ID Q9BZ72
UniProtKB/Swiss-Prot Entry Name PITM2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020845.2
GeneCard ID PITPNM2
GenAtlas ID PITPNM2
HGNC ID HGNC:21044
References
General References
  1. Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Apr 28;7(2):143-50. [PubMed:10819331 ]
  2. Lev S, Hernandez J, Martinez R, Chen A, Plowman G, Schlessinger J: Identification of a novel family of targets of PYK2 related to Drosophila retinal degeneration B (rdgB) protein. Mol Cell Biol. 1999 Mar;19(3):2278-88. [PubMed:10022914 ]