Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07338
Secondary Accession Numbers
  • 12960
Name Membrane-associated phosphatidylinositol transfer protein 3
Synonyms
  1. NIR-1
  2. PITPnm 3
  3. Phosphatidylinositol transfer protein, membrane-associated 3
  4. Pyk2 N-terminal domain-interacting receptor 1
Gene Name PITPNM3
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro). Binds calcium ions
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
Process
establishment of localization
transport
Cellular Location
  1. Endomembrane system
  2. Peripheral membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13
SNPs PITPNM3
Gene Sequence
>2925 bp
ATGGCCAAGGCGGGCCGTGCAGGTGGTCCTCCCCCGGGCGGCGGTGCCCCCTGGCACCTT
CGAAATGTCCTCAGTGACTCTGTGGAGAGCTCAGATGATGAATTCTTTGATGCCAGAGAG
GAGATGGCTGAAGGGAAGAATGCCATCCTCATTGGGATGAGCCAGTGGAACTCCAATGAC
CTCGTGGAGCAGATCGAGACCATGGGGAAACTGGACGAGCATCAAGGAGAAGGGACCGCG
CCGTGCACATCCAGCATCCTCCAGGAGAAGCAGCGAGAACTGTACCGGGTTTCCTTGAGA
AGACAGAGGTTCCCAGCCCAGGGAAGCATCGAGATCCACGAAGACAGCGAGGAAGGCTGC
CCGCAGCGCTCCTGCAAGACACATGTCCTCCTGCTGGTCCTGCATGGGGGAAACATCCTG
GACACGGGTGCCGGGGACCCGTCCTGCAAGGCAGCCGACATCCACACCTTCAGCTCCGTG
CTGGAGAAGGTCACACGAGCCCATTTCCCTGCTGCCCTGGGCCACATCCTCATCAAGTTC
GTCCCCTGTCCTGCCATCTGCTCTGAGGCTTTCTCGCTTGTCTCTCACCTGAACCCCTAC
AGCCACGATGAGGGCTGCCTCAGCAGCAGCCAGGACCACGTCCCTCTGGCCGCCCTTCCC
CTGTTGGCCATCTCCTCCCCGCAGTACCAGGATGCTGTCGCCACCGTCATCGAGCGAGCC
AACCAGGTCTACAGAGAGTTCCTGAAGTCCTCTGATGGGATTGGCTTCAGTGGGCAGGTG
TGTCTCATCGGGGACTGTGTGGGGGGCCTCCTGGCCTTCGATGCCATCTGCTACAGTGCG
GGGCCCTCAGGGGACAGCCCTGCCAGCAGCAGCCGGAAGGGGAGCATCAGCAGCACCCAG
GACACCCCAGTCGCGGTGGAGGAAGATTGCAGCCTGGCCAGCAGCAAGCGTCTCAGCAAA
AGCAACATTGACATCTCCAGTGGGTTGGAGGATGAGGAGCCCAAGAGGCCGTTGCCGCGG
AAACAGAGCGACTCCTCCACCTATGACTGCGAGGCCATCACCCAGCACCATGCCTTCCTC
TCAAGCATCCACTCCAGCGTGCTAAAGGATGAGTCTGAGACCCCGGCGGCTGGGGGGCCG
CAGCTCCCTGAGGTCAGCCTGGGCCGCTTTGACTTCGATGTGTCCGACTTCTTCCTCTTC
GGCTCGCCACTGGGCCTGGTCCTGGCCATGCGGAGGACGGTGCTGCCTGGGCTGGACGGC
TTCCAGGTGCGTCCTGCCTGCAGCCAGGTCTACAGCTTCTTCCATTGCGCAGACCCCTCT
GCCTCACGGCTCGAGCCACTGCTGGAGCCCAAGTTCCACCTGGTGCCGCCTGTCAGCGTG
CCTCGCTACCAGAGGTTCCCACTGGGCGATGGGCAGTCCCTCCTCCTCGCTGATGCCCTA
CACACCCACAGCCCCCTCTTCCTGGAGGGCAGCTCCCGGGACAGCCCGCCACTTCTGGAT
GCCCCTGCCTCGCCCCCTCAGGCCTCGAGGTTCCAGCGCCCAGGACGGAGGATGAGCGAG
GGGAGCTCCCACAGCGAGAGCTCGGAGTCCTCGGACAGCATGGCACCCGTGGGTGCCTCC
CGCATCACAGCCAAGTGGTGGGGAAGCAAGAGGATCGACTATGCCCTGTACTGCCCTGAT
GTCCTCACGGCCTTCCCCACCGTGGCCCTGCCCCACCTCTTCCACGCCAGTTACTGGGAG
TCCACAGACGTGGTGGCCTTCATCCTGAGACAGGTAATGCGCTATGAGAGCGTGAACATC
AAGGAAAGCGCCCGCCTGGACCCTGCAGCACTGAGTCCTGCCAACCCCCGGGAGAAGTGG
CTTCGTAAGCGGACTCAGGTCAAGCTGAGGAATGTCACGGCTAATCACCGGGCCAATGAT
GTGATTGCTGCTGAAGATGGCCCCCAGGTCCTGGTGGGGCGGTTCATGTACGGGCCCCTC
GACATGGTGGCTCTGACTGGAGAGAAGGTGGACATCCTAGTAATGGCAGAGCCATCCTCA
GGCCGCTGGGTACACCTGGACACAGAGATCACCAACAGCAGTGGTCGCATCACATACAAT
GTGCCGCGGCCCCGGCGCCTGGGGGTTGGTGTCTATCCTGTGAAGATGGTCGTCAGGGGC
GACCAGACCTGTGCCATGAGCTACCTCACGGTGTTGCCCAGGGGCATGGAGTGTGTAGTG
TTCAGCATTGATGGGTCCTTCGCGGCCAGCGTGTCTATCATGGGAAGCGACCCCAAGGTC
CGGCCGGGTGCAGTGGATGTTGTCCGGCACTGGCAGGACTTGGGCTACATGATCCTTTAC
ATCACGGGACGGCCGGACATGCAGAAGCAGCGGGTGGTGTCGTGGCTGTCCCAGCACAAC
TTCCCACAGGGCATGATCTTCTTCTCCGATGGGCTGGTGCATGACCCGCTGCGGCAGAAG
GCCATCTTCCTGCGCAACCTCATGCAGGAGTGCTTCATCAAAATCAGTGCGGCCTATGGC
TCCACGAAGGACATCTCTGTCTACAGCGTGCTGGGCCTGCCTGCCTCCCAGATCTTCATT
GTGGGCCGGCCCACCAAGAAGTACCAAACCCAGTGCCAGTTCCTGAGCGAGGGCTACGCC
GCACACCTGGCCGCGCTGGAGGCCAGCCACCGCTCACGCCCAAAGAAGAACAACTCGCGC
ATGATCCTGCGCAAGGGCAGCTTCGGGCTGCACGCGCAGCCAGAGTTCCTGCGGAAGCGC
AACCACCTGCGCAGAACCATGTCAGTGCAGCAGCCCGACCCGCCCGCCGCCAACCCCAAG
CCCGAGCGGGCCCAGAGCCAGCCCGAGTCGGACAAAGACCACGAGCGGCCGCTGCCGGCG
CTCAGCTGGGCGCGTGGGCCCCCCAAGTTCGAGTCGGTGCCCTGA
Protein Properties
Number of Residues 974
Molecular Weight 106780.1
Theoretical pI 7.14
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Membrane-associated phosphatidylinositol transfer protein 3
MAKAGRAGGPPPGGGAPWHLRNVLSDSVESSDDEFFDAREEMAEGKNAILIGMSQWNSND
LVEQIETMGKLDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGC
PQRSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKF
VPCPAICSEAFSLVSHLNPYSHDEGCLSSSQDHVPLAALPLLAISSPQYQDAVATVIERA
NQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAICYSAGPSGDSPASSSRKGSISSTQ
DTPVAVEEDCSLASSKRLSKSNIDISSGLEDEEPKRPLPRKQSDSSTYDCEAITQHHAFL
SSIHSSVLKDESETPAAGGPQLPEVSLGRFDFDVSDFFLFGSPLGLVLAMRRTVLPGLDG
FQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADAL
HTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGAS
RITAKWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVMRYESVNI
KESARLDPAALSPANPREKWLRKRTQVKLRNVTANHRANDVIAAEDGPQVLVGRFMYGPL
DMVALTGEKVDILVMAEPSSGRWVHLDTEITNSSGRITYNVPRPRRLGVGVYPVKMVVRG
DQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILY
ITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYG
STKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAALEASHRSRPKKNNSR
MILRKGSFGLHAQPEFLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPA
LSWARGPPKFESVP
GenBank ID Protein 190358515
UniProtKB/Swiss-Prot ID Q9BZ71
UniProtKB/Swiss-Prot Entry Name PITM3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031220.3
GeneCard ID PITPNM3
GenAtlas ID PITPNM3
HGNC ID HGNC:21043
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  4. Lev S, Hernandez J, Martinez R, Chen A, Plowman G, Schlessinger J: Identification of a novel family of targets of PYK2 related to Drosophila retinal degeneration B (rdgB) protein. Mol Cell Biol. 1999 Mar;19(3):2278-88. [PubMed:10022914 ]
  5. Kohn L, Kadzhaev K, Burstedt MS, Haraldsson S, Hallberg B, Sandgren O, Golovleva I: Mutation in the PYK2-binding domain of PITPNM3 causes autosomal dominant cone dystrophy (CORD5) in two Swedish families. Eur J Hum Genet. 2007 Jun;15(6):664-71. Epub 2007 Mar 21. [PubMed:17377520 ]