You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07341
Secondary Accession Numbers
  • 12963
Name PI-PLC X domain-containing protein 3
Synonyms Not Available
Gene Name PLCXD3
Protein Type Enzyme
Biological Properties
General Function Involved in phosphoric diester hydrolase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
phospholipase c activity
lipase activity
phospholipase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:5
Locus 5p13.1
SNPs PLCXD3
Gene Sequence
>966 bp
ATGGCCTCGTCTCAGGGGAAAAACGAGCTGAAATTAGCCGACTGGATGGCAACTCTGCCG
GAGAGCATGCACAGCATCCCCCTCACCAATTTAGCCATTCCAGGGTCTCATGATTCCTTC
AGCTTCTACATTGATGAAGCCTCTCCAGTAGGTCCTGAGCAGCCAGAAACTGTCCAGAAT
TTTGTCTCTGTGTTTGGAACTGTGGCCAAAAAGCTCATGCGGAAATGGTTAGCCACTCAG
ACAATGAATTTTACTGGCCAGCTAGGAGCTGGAATTCGTTATTTTGATCTTCGAATTTCC
ACCAAGCCCAGAGACCCCGACAATGAACTCTATTTTGCTCATGGTTTGTTCAGTGCCAAA
GTCAATGAAGGCCTTGAGGAGATCAATGCATTCCTCACAGATCACCATAAGGAGGTAGTG
TTCTTGGACTTCAACCACTTTTATGGGATGCAGAAATATCACCATGAAAAACTGGTCCAA
ATGCTGAAAGACATCTATGGAAATAAAATGTGCCCAGCGATTTTTGCCCAGGAAGTTAGT
TTAAAGTACCTGTGGGAGAAGGACTATCAAGTGCTGGTCTTCTACCATAGTCCAGTGGCT
CTGGAAGTGCCCTTTCTCTGGCCTGGGCAGATGATGCCAGCACCCTGGGCCAACACCACA
GACCCCGAGAAACTGATCCAGTTTCTTCAAGCATCCATCACTGAGAGAAGAAAGAAGGGA
TCGTTTTTTATATCTCAGGTGGTGCTGACCCCCAAAGCTAGCACTGTGGTCAAAGGGGTG
GCAAGTGGCCTCAGAGAAACAATCACAGAAAGAGCTCTTCCTGCCATGATGCAGTGGGTC
CGCACGCAGAAGCCAGGAGAGAGTGGCATCAATATTGTCACTGCCGATTTTGTAGAACTT
GGTGACTTTATCAGCACTGTCATAAAGCTCAACTATGTCTTTGATGAAGGAGAAGCCAAC
ACTTGA
Protein Properties
Number of Residues 321
Molecular Weight 36312.5
Theoretical pI 6.24
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>PI-PLC X domain-containing protein 3
MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQN
FVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK
VNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS
LKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKG
SFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFDEGEANT
GenBank ID Protein 53828920
UniProtKB/Swiss-Prot ID Q63HM9
UniProtKB/Swiss-Prot Entry Name PLCX3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001005473.2
GeneCard ID PLCXD3
GenAtlas ID PLCXD3
HGNC ID HGNC:31822
References
General References
  1. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]