You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07345
Secondary Accession Numbers
  • 12967
Name Transmembrane protein 55B
Synonyms
  1. PtdIns-4,5-P2 4-Ptase I
  2. Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase
Gene Name TMEM55B
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate. Does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate.
Pathways Not Available
Reactions
1-phosphatidyl-myo-inositol 4,5-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 5-phosphate + Phosphate details
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + Water → 1-phosphatidyl-1D-myo-inositol 5-phosphate + Phosphate details
GO Classification
Cellular Component
late endosome membrane
lysosomal membrane
integral to membrane
Molecular Function
hydrolase activity
Cellular Location
  1. Late endosome membrane
  2. Lysosome membrane
  3. Multi-pass membrane protein
  4. Multi-pass membrane protein
Gene Properties
Chromosome Location 14
Locus 14q11.2
SNPs TMEM55B
Gene Sequence
>834 bp
ATGGCGGCAGATGGAGAGCGTTCCCCGCTGCTGTCTGAGCCCATCGACGGTGGCGCGGGC
GGCAACGGTTTAGTGGGGCCCGGCGGGAGTGGGGCTGGGCCCGGGGGAGGCCTGACCCCC
TCCGCACCACCGTACGGAGCCGCATTTCCCCCGTTTCCCGAGGGGCATCCAGCCGTGTTG
CCTGGGGAGGACCCACCCCCCTATTCACCCTTAACTAGCCCGGACAGTGGGAGTGCCCCT
ATGATCACCTGCCGAGTCTGCCAATCTCTCATCAACGTGGAAGGCAAGATGCATCAGCAT
GTAGTCAAATGTGGTGTCTGCAATGAAGCCACCCCAATCAAGAATGCACCCCCAGGGAAA
AAATATGTTCGATGCCCCTGTAACTGTCTCCTTATCTGCAAAGTGACATCCCAACGGATT
GCATGCCCTCGGCCCTACTGCAAAAGAATCATCAACCTGGGGCCTGTGCATCCCGGACCT
CTGAGTCCAGAACCCCAACCCATGGGTGTCAGGGTTATCTGTGGACATTGCAAGAATACT
TTTCTGTGGACAGAGTTCACAGACCGCACTTTGGCACGTTGTCCTCACTGCAGGAAAGTG
TCATCTATTGGGCGCAGATACCCACGTAAGAGATGTATCTGCTGCTTCTTGCTTGGCTTG
CTTTTGGCAGTCACTGCCACTGGCCTTGCCTTTGGCACATGGAAGCATGCACGGCGATAT
GGAGGCATCTATGCAGCCTGGGCATTTGTCATCCTGTTGGCTGTGCTGTGTTTGGGCCGG
GCTCTTTATTGGGCCTGTATGAAGGTCAGCCACCCTGTCCAGAACTTCTCCTGA
Protein Properties
Number of Residues 277
Molecular Weight 30185.125
Theoretical pI 8.98
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Transmembrane protein 55B
MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVL
PGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGK
KYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNT
FLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRY
GGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS
GenBank ID Protein 189054212
UniProtKB/Swiss-Prot ID Q86T03
UniProtKB/Swiss-Prot Entry Name TM55B_HUMAN
PDB IDs Not Available
GenBank Gene ID AK314021
GeneCard ID TMEM55B
GenAtlas ID TMEM55B
HGNC ID HGNC:19299
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Ungewickell A, Hugge C, Kisseleva M, Chang SC, Zou J, Feng Y, Galyov EE, Wilson M, Majerus PW: The identification and characterization of two phosphatidylinositol-4,5-bisphosphate 4-phosphatases. Proc Natl Acad Sci U S A. 2005 Dec 27;102(52):18854-9. Epub 2005 Dec 19. [PubMed:16365287 ]