Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07364
Secondary Accession Numbers
  • 13009
Name Acetolactate synthase-like protein
Synonyms
  1. IlvB-like protein
Gene Name ILVBL
Protein Type Unknown
Biological Properties
General Function Involved in magnesium ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
magnesium ion binding
vitamin binding
thiamin pyrophosphate binding
Cellular Location
  1. Membrane
  2. Single-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.1
SNPs ILVBL
Gene Sequence
>1899 bp
ATGGAGACCCCCGCGGCCGCCGCCCCCGCTGGGAGCTTATTCCCCTCCTTCCTGCTCCTG
GCCTGCGGGACGCTGGTGGCCGCCTTGCTGGGCGCCGCTCACCGCCTGGGGCTCTTCTAT
CAGCTGCTGCACAAGGTGGACAAGGCAAGCGTCCGGCATGGCGGAGAGAACGTGGCCGCT
GTGCTGAGGGCCCATGGTGTGCGGTTCATCTTCACGCTGGTCGGTGGGCACATTTCCCCG
CTGCTGGTGGCCTGTGAGAAACTGGGCATCCGTGTGGTGGACACACGCCATGAGGTCACG
GCCGTCTTTGCTGCTGATGCTATGGCCCGCCTGTCCGGGACGGTGGGCGTGGCGGCAGTG
ACAGCAGGCCCTGGCCTCACCAACACGGTGACTGCGGTGAAGAATGCTCAGATGGCTCAG
TCCCCAATCCTGCTTCTGGGTGGGGCTGCCAGCACTCTGCTGCAGAACCGGGGTGCGCTC
CAGGCTGTTGATCAGCTGTCCCTTTTCCGGCCACTCTGTAAGTTTTGTGTGTCTGTGCGG
AGGGTGCGGGACATTGTGCCCACCCTGAGGGCCGCGATGGCTGCCGCCCAGTCGGGCACC
CCAGGTCCGGTGTTTGTGGAGCTGCCCGTTGACGTGCTGTACCCCTACTTCATGGTCCAG
AAGGAGATGGTGCCAGCCAAGCCACCCAAGGGCCTCGTGGGCCGAGTGGTCTCCTGGTAT
TTAGAGAATTACCTGGCCAACCTCTTTGCAGGAGCCTGGGAGCCTCAGCCCGAGGGACCG
CTGCCCCTGGACATCCCCCAGGCTTCCCCGCAGCAGGTTCAGCGCTGTGTGGAGATCCTG
AGCCGGGCCAAGAGGCCTCTGATGGTGCTGGGGAGTCAGGCCCTGCTCACCCCAACGTCT
GCCGACAAGCTTCGGGCTGCCGTGGAGACCTTGGGTGTTCCCTGCTTCCTTGGAGGGATG
GCACGGGGGCTGTTAGGCCGCAACCACCCCCTCCACATCCGGGAGAACCGCAGTGCGGCC
CTGAAGAAGGCGGATGTCATTGTCCTAGCAGGAACTGTGTGTGACTTCCGCCTATCCTAT
GGCCGTGTCCTCAGCCACAGCAGCAAGATCATCATCGTCAATCGTAATCGGGAAGAGATG
TTGCTCAACTCAGACATCTTCTGGAAGCCCCAGGAGGCTGTGCAGGGAGATGTGGGTTCC
TTCGTGCTGAAGTTAGTGGAGGGCCTTCAGGGCCAGACCTGGGCCCCAGACTGGGTGGAG
GAGCTGCGGGAAGCCGACCGGCAGAAGGAGCAGACCTTTCGGGAGAAGGCAGCGATGCCT
GTGGCCCAGCACCTGAACCCAGTGCAGGTGCTGCAGCTGGTGGAGGAAACGCTACCTGAC
AACTCAATTCTGGTGGTGGATGGCGGGGACTTCGTGGGCACTGCTGCCCATCTGGTACAG
CCCCGCGGCCCCCTGCGCTGGCTCGATCCTGGGGCCTTTGGGACTCTGGGAGTTGGTGCA
GGATTTGCACTTGGGGCCAAGCTGTGCCGGCCAGATGCTGAGGTCTGGTGCCTGTTTGGG
GACGGAGCTTTTGGCTACAGCCTCATCGAATTTGATACATTCGTCAGACACAAGATCCCA
GTGATGGCCTTGGTAGGGAATGATGCTGGCTGGACACAGATTTCTCGGGAGCAGGTGCCC
TCTCTGGGCAGCAACGTGGCCTGTGGCCTGGCCTACACTGATTATCACAAGGCAGCCATG
GGTCTGGGGGCCCGGGGCTTGCTGCTCTCACGGGAGAACGAGGATCAGGTGGTCAAGGTG
CTGCACGATGCCCAGCAGCAGTGCCGAGACGGCCACCCGGTTGTGGTCAACATCCTCATT
GGGAGGACGGACTTCCGCGATGGCTCCATTGCTGTATAG
Protein Properties
Number of Residues 632
Molecular Weight 67867.2
Theoretical pI 8.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 13-33
Protein Sequence
>Acetolactate synthase-like protein
METPAAAAPAGSLFPSFLLLACGTLVAALLGAAHRLGLFYQLLHKVDKASVRHGGENVAA
VLRAHGVRFIFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAMARLSGTVGVAAV
TAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVR
RVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWY
LENYLANLFAGAWEPQPEGPLPLDIPQASPQQVQRCVEILSRAKRPLMVLGSQALLTPTS
ADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLAGTVCDFRLSY
GRVLSHSSKIIIVNRNREEMLLNSDIFWKPQEAVQGDVGSFVLKLVEGLQGQTWAPDWVE
ELREADRQKEQTFREKAAMPVAQHLNPVQVLQLVEETLPDNSILVVDGGDFVGTAAHLVQ
PRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIP
VMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGARGLLLSRENEDQVVKV
LHDAQQQCRDGHPVVVNILIGRTDFRDGSIAV
GenBank ID Protein 2725625
UniProtKB/Swiss-Prot ID A1L0T0
UniProtKB/Swiss-Prot Entry Name ILVBL_HUMAN
PDB IDs Not Available
GenBank Gene ID AC003956
GeneCard ID ILVBL
GenAtlas ID ILVBL
HGNC ID HGNC:6041
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Joutel A, Ducros A, Alamowitch S, Cruaud C, Domenga V, Marechal E, Vahedi K, Chabriat H, Bousser MG, Tournier-Lasserve E: A human homolog of bacterial acetolactate synthase genes maps within the CADASIL critical region. Genomics. 1996 Dec 1;38(2):192-8. [PubMed:8954801 ]