You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07403
Secondary Accession Numbers
  • 13073
Name Peroxisomal NADH pyrophosphatase NUDT12
Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 12
  2. Nudix motif 12
Gene Name NUDT12
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Hydrolyzes NAD(P)H to NMNH and AMP (2',5'-ADP), and diadenosine diphosphate to AMP. Has also activity towards NAD(P)(+), ADP-ribose and diadenosine triphosphate. May act to regulate the concentration of peroxisomal nicotinamide nucleotide cofactors required for oxidative metabolism in this organelle.
Pathways
  • Nicotinate and Nicotinamide Metabolism
  • Nicotinate and nicotinamide metabolism
  • Peroxisome
Reactions
NAD + Water → Adenosine monophosphate + beta-nicotinamide D-ribonucleotide details
Nicotinic acid adenine dinucleotide + Water → Adenosine monophosphate + nicotinate beta-D-ribonucleotide details
GO Classification
Biological Process
NAD catabolic process
NADP catabolic process
Cellular Component
nucleus
peroxisome
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
Molecular Function
NAD+ diphosphatase activity
metal ion binding
NADH pyrophosphatase activity
Cellular Location
  1. Peroxisome
Gene Properties
Chromosome Location 5
Locus 5q21.2
SNPs NUDT12
Gene Sequence
>1389 bp
ATGTCTTCTGTAAAAAGAAGTCTGAAGCAAGAAATAGTTACTCAGTTTCACTGTTCAGCT
GCTGAAGGAGATATTGCCAAGTTAACAGGAATACTCAGTCATTCTCCATCTCTTCTCAAT
GAAACTTCTGAAAATGGCTGGACTGCTTTAATGTATGCGGCAAGGAATGGGCACCCAGAG
ATAGTCCAATTTCTGCTTGAGAAAGGGTGTGACAGATCAATTGTCAATAAATCAAGGCAG
ACTGCACTGGATATTGCTGTATTTTGGGGTTATAAGCATATAGCTAATTTACTAGCTACT
GCTAAAGGTGGGAAGAAGCCTTGGTTCCTAACGAATGAAGTGGAAGAATGTGAAAATTAT
TTTAGCAAAACACTACTGGACCGGAAAAGTGAAAAGAGGAATAATTCTGACTGGCTGCTA
GCTAAAGAAAGCCATCCAGCCACAGTTTTTATTCTTTTCTCAGATTTAAATCCCTTGGTT
ACTCTAGGTGGCAATAAAGAAAGTTTCCAACAGCCAGAAGTTAGGCTTTGTCAGCTGAAC
TACACAGATATAAAGGATTATTTGGCCCAGCCTGAGAAGATCACCTTGATTTTTCTTGGA
GTAGAACTTGAAATAAAAGACAAACTACTTAATTATGCTGGTGAAGTCCCGAGAGAGGAG
GAAGATGGATTGGTTGCCTGGTTTGCTCTAGGTATAGATCCTATTGCTGCTGAAGAATTC
AAGCAAAGACATGAAAATTGTTACTTTCTTCATCCTCCTATGCCAGCCCTTCTGCAATTG
AAAGAAAAAGAAGCTGGGGTTGTAGCTCAAGCAAGATCTGTTCTTGCCTGGCACAGTCGA
TACAAGTTTTGCCCAACCTGTGGAAATGCAACTAAAATTGAAGAAGGTGGCTATAAGAGA
CTATGTTTAAAAGAAGACTGTCCTAGTCTCAATGGCGTCCATAATACCTCATACCCAAGA
GTTGATCCAGTAGTAATCATGCAAGTTATTCATCCAGATGGGACCAAATGCCTTTTAGGC
AGGCAGAAAAGATTTCCCCCAGGCATGTTTACTTGCCTTGCTGGATTTATTGAGCCTGGA
GAGACAATAGAAGATGCTGTTAGGAGAGAAGTAGAAGAGGAAAGTGGAGTCAAAGTTGGC
CATGTTCAGTATGTTGCTTGTCAACCATGGCCAATGCCTTCCTCCTTAATGATTGGTTGC
TTAGCTCTAGCAGTGTCTACAGAAATTAAAGTTGACAAGAATGAAATAGAGGATGCCCGC
TGGTTCACTAGAGAACAGGTCCTGGATGTTCTGACCAAAGGGAAGCAGCAGGCATTCTTT
GTGCCACCAAGCCGAGCTATTGCACATCAATTAATCAAACACTGGATTAGAATAAATCCT
AATCTCTAA
Protein Properties
Number of Residues 462
Molecular Weight 52075.475
Theoretical pI 6.829
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Peroxisomal NADH pyrophosphatase NUDT12
MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPE
IVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENY
FSKTLLDRKSEKRNNSDWLLAKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLN
YTDIKDYLAQPEKITLIFLGVELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR
LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL
GenBank ID Protein 193783663
UniProtKB/Swiss-Prot ID Q9BQG2
UniProtKB/Swiss-Prot Entry Name NUD12_HUMAN
PDB IDs Not Available
GenBank Gene ID AK098066
GeneCard ID NUDT12
GenAtlas ID NUDT12
HGNC ID HGNC:18826
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Abdelraheim SR, Spiller DG, McLennan AG: Mammalian NADH diphosphatases of the Nudix family: cloning and characterization of the human peroxisomal NUDT12 protein. Biochem J. 2003 Sep 1;374(Pt 2):329-35. [PubMed:12790796 ]