You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07412
Secondary Accession Numbers
  • 13102
Name FAD synthase
Synonyms
  1. FAD pyrophosphorylase
  2. FAD synthase region
  3. FMN adenylyltransferase
  4. Flavin adenine dinucleotide synthase
  5. Molybdenum cofactor biosynthesis protein-like region
Gene Name FLAD1
Protein Type Unknown
Biological Properties
General Function Involved in FMN adenylyltransferase activity
Specific Function Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
Pathways
  • FAD biosynthesis
  • Riboflavin metabolism
  • Riboflavin Metabolism
Reactions
Adenosine triphosphate + Flavin mononucleotide → Pyrophosphate + FAD details
GO Classification
Biological Process
riboflavin metabolic process
FAD biosynthetic process
Mo-molybdopterin cofactor biosynthetic process
Cellular Component
cytosol
Function
fmn adenylyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
adenylyltransferase activity
Molecular Function
ATP binding
FMN adenylyltransferase activity
Process
fadh2 metabolic process
fad biosynthetic process
metabolic process
coenzyme biosynthetic process
cellular metabolic process
oxidoreduction coenzyme metabolic process
cofactor metabolic process
coenzyme metabolic process
mo-molybdopterin cofactor biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q21.3
SNPs FLAD1
Gene Sequence
>1764 bp
ATGGGTTGGGATTTGGGAACACGTTTATTCCAGAGGCAGGAACAAAGGAGTCGCTTGTCA
AGGATCTGGTTAGAGAAGACTAGGGTCTTCCTCGAAGGAAGCACGCGCACGCCTGCTCTC
CCCCATTGTCTTTTCTGGCTTCTCCAGGTTCCCTCGACCCAGGACCCCCTGTTCCCAGGC
TATGGCCCCCAGTGCCCTGTAGACCTGGCAGGCCCCCCGTGCTTGCGACCCCTATTTGGG
GGTCTGGGTGGCTACTGGAGGGCCTTGCAGAGGGGCAGAGAAGGCAGGACCATGACATCT
AGGGCCTCTGAACTTTCTCCGGGGCGCAGCGTGACGGCTGGCATCATCATTGTTGGAGAT
GAGATCCTTAAGGGACACACTCAGGACACCAACACCTTCTTTCTGTGCCGGACACTGCGC
TCCCTAGGGGTCCAGGTTTGCCGAGTCTCAGTTGTACCTGATGAGGTAGCCACCATTGCA
GCTGAGGTCACTTCTTTCTCCAACCGCTTCACCCATGTCCTCACAGCAGGGGGCATCGGC
CCCACTCATGATGATGTGACCTTTGAGGCAGTGGCACAGGCCTTTGGAGATGAGCTGAAG
CCACACCCCAAGTTGGAAGCAGCCACCAAAGCCCTAGGAGGGGAAGGCTGGGAGAAGCTA
TCATTGGTGCCCTCCTCTGCCCGCCTGCATTATGGCACAGATCCTTGCACTGGTCAACCT
TTCAGATTCCCTCTGGTCTCCGTCCGAAACGTCTACCTCTTCCCAGGCATTCCAGAGCTG
CTGCGGCGGGTGCTGGAGGGGATGAAGGGACTATTCCAAAACCCAGCTGTTCAGTTCCAC
TCAAAGGAGCTATATGTGGCTGCTGATGAAGCCTCCATCGCCCCCATTCTGGCTGAGGCC
CAGGCCCACTTTGGACGTAGGCTTGGCCTGGGTTCCTACCCTGACTGGGGCAGCAACTAC
TATCAGGTGAAGCTGACTCTAGACTCAGAGGAAGAAGGACCCCTGGAGGAATGCTTGGCC
TACCTGACTGCCCGTTTGCCCCAGGGATCGCTGGTCCCCTACATGCCCAACGCTGTGGAG
CAGGCCAGTGAGGCTGTATACAAACTCGCTGAATCAGGGTCTTCTTTGGGGAAAAAGGTG
GCAGGTGCCCTACAGACCATTGAGACCTCCCTGGCTCAGTACAGCCTCACCCAGCTCTGT
GTGGGCTTCAACGGGGGCAAAGACTGCACTGCCCTCCTGCACCTCTTCCATGCAGCTGTG
CAGAGGAAATTACCTGATGTTCCAAACCCCCTCCAGATCCTGTATATCCGCAGCATCTCC
CCTTTCCCTGAGCTGGAACAGTTTCTACAGGACACTATCAAGAGGTATAATCTGCAGATG
TTGGAAGCTGAGGGCAGCATGAAGCAGGCCCTGGGTGAACTGCAGGCACGGCACCCCCAG
CTGGAGGCTGTCCTTATGGGCACCCGCCGGACTGACCCCTACTCCTGTAGCCTCTGCCCT
TTCAGCCCCACTGACCCAGGCTGGCCCGCATTCATGCGCATCAACCCACTGCTGGACTGG
ACCTACAGAGACATCTGGGATTTTCTGCGTCAGCTGTTTGTCCCATACTGTATCCTGTAT
GACCGAGGATACACATCACTGGGGAGTCGGGAGAATACCGTGCGGAACCCGGCCCTGAAG
TGCCTGAGCCCAGGAGGACACCCCACATACCGTCCAGCCTATCTACTGGAGAACGAAGAA
GAGGAGCGGAACTCCCGCACATGA
Protein Properties
Number of Residues 587
Molecular Weight 49197.795
Theoretical pI 5.962
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>FAD synthase
MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPG
YGPQCPVDLAGPPCLRPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGD
EILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIG
PTHDDVTFEAVAQAFGDELKPHPKLEAATKALGGEGWEKLSLVPSSARLHYGTDPCTGQP
FRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEA
QAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVE
QASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAV
QRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQ
LEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILY
DRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEEEERNSRT
GenBank ID Protein 41872389
UniProtKB/Swiss-Prot ID Q8NFF5
UniProtKB/Swiss-Prot Entry Name FAD1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_025207.4
GeneCard ID FLAD1
GenAtlas ID FLAD1
HGNC ID HGNC:24671
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  7. Yu W, Andersson B, Worley KC, Muzny DM, Ding Y, Liu W, Ricafrente JY, Wentland MA, Lennon G, Gibbs RA: Large-scale concatenation cDNA sequencing. Genome Res. 1997 Apr;7(4):353-8. [PubMed:9110174 ]
  8. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. [PubMed:15498874 ]
  9. Brizio C, Galluccio M, Wait R, Torchetti EM, Bafunno V, Accardi R, Gianazza E, Indiveri C, Barile M: Over-expression in Escherichia coli and characterization of two recombinant isoforms of human FAD synthetase. Biochem Biophys Res Commun. 2006 Jun 9;344(3):1008-16. Epub 2006 Apr 19. [PubMed:16643857 ]
  10. Galluccio M, Brizio C, Torchetti EM, Ferranti P, Gianazza E, Indiveri C, Barile M: Over-expression in Escherichia coli, purification and characterization of isoform 2 of human FAD synthetase. Protein Expr Purif. 2007 Mar;52(1):175-81. Epub 2006 Sep 12. [PubMed:17049878 ]