You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07427
Secondary Accession Numbers
  • 13135
Name Bestrophin-4
Synonyms
  1. Vitelliform macular dystrophy 2-like protein 2
Gene Name BEST4
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function Forms calcium-sensitive chloride channels. Permeable to bicarbonate
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1p33-p32.3
SNPs BEST4
Gene Sequence
>1422 bp
ATGACGGTTTCATACACTCTCAAAGTGGCGGAGGCCCGCTTCGGAGGTTTCTCTGGCCTG
CTTCTCCGCTGGAGGGGAAGCATCTACAAGCTCCTCTACAAGGAATTCCTCCTCTTTGGG
GCCTTGTACGCTGTGCTTAGCATCACCTACCGGCTGCTGCTGACCCAGGAGCAGAGGTAC
GTGTATGCTCAGGTGGCCCGGTACTGCAACCGCTCAGCAGACCTCATTCCCTTGTCCTTT
GTATTGGGTTTCTATGTGACTCTCGTGGTGAACCGCTGGTGGTCCCAGTACACAAGCATC
CCGCTGCCAGACCAGCTGATGTGCGTCATCTCGGCTAGCGTGCACGGCGTGGACCAGCGG
GGCCGCCTGCTGCGCCGCACCCTCATCCGCTACGCGAACCTGGCGTCCGTGCTGGTGCTG
CGCTCGGTCAGCACCCGCGTGCTTAAGCGCTTCCCCACCATGGAGCACGTGGTGGACGCA
GGTTTCATGTCCCAGGAAGAGAGGAAAAAGTTTGAGAGCCTGAAATCCGACTTCAACAAG
TACTGGGTCCCCTGCGTCTGGTTCACCAACCTGGCGGCCCAGGCCCGGAGGGACGGGCGA
ATACGTGACGATATCGCTCTCTGTCTACTTTTGGAAGAGCTGAACAAGTACCGAGCCAAG
TGCAGCATGCTATTCCACTATGACTGGATCAGCATCCCCCTCGTCTACACCCAAGTGGTG
ACCATAGCCGTCTACTCTTTCTTTGCCCTCTCCCTGGTTGGCCGCCAGTTTGTGGAGCCA
GAGGCAGGGGCTGCCAAACCTCAGAAGCTTCTGAAGCCAGGCCAGGAGCCAGCCCCAGCC
CTGGGAGACCCGGACATGTACGTGCCTCTCACCACTCTGCTGCAGTTCTTCTTCTATGCT
GGCTGGCTCAAGGTGGCTGAACAGATCATCAACCCATTTGGTGAGGATGATGACGACTTT
GAGACAAATCAGCTCATAGACCGCAACTTGCAGGTGTCCCTGCTATCCGTGGACGAAATG
TACCAGAACCTTCCCCCCGCTGAGAAGGACCAGTACTGGGATGAGGACCAGCCGCAGCCA
CCCTACACTGTGGCCACGGCGGCCGAGTCTCTGCGGCCCTCATTCCTGGGCTCCACCTTC
AACCTGCGCATGAGCGACGACCCTGAGCAGAGCCTGCAGGTGGAGGCGTCCCCCGGATCT
GGTCGGCCCGCGCCCGCCGCGCAGACCCCGTTGCTCGGCCGCTTCCTGGGCGTAGGGGCG
CCCTCCCCGGCCATCAGCCTCCGGAACTTCGGCCGCGTGCGAGGCACCCCCCGCCCCCCG
CATCTGCTGCGCTTCCGGGCGGAGGAGGGCGGCGACCCCGAGGCCGCAGCCCGCATCGAG
GAGGAATCGGCGGAGTCCGGGGACGAGGCCCTGGAGCCCTGA
Protein Properties
Number of Residues 473
Molecular Weight 53496.7
Theoretical pI 5.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 26-46
  • 71-91
  • 179-199
  • 286-306
Protein Sequence
>Bestrophin-4
MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITYRLLLTQEQRY
VYAQVARYCNRSADLIPLSFVLGFYVTLVVNRWWSQYTSIPLPDQLMCVISASVHGVDQR
GRLLRRTLIRYANLASVLVLRSVSTRVLKRFPTMEHVVDAGFMSQEERKKFESLKSDFNK
YWVPCVWFTNLAAQARRDGRIRDDIALCLLLEELNKYRAKCSMLFHYDWISIPLVYTQVV
TIAVYSFFALSLVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDMYVPLTTLLQFFFYA
GWLKVAEQIINPFGEDDDDFETNQLIDRNLQVSLLSVDEMYQNLPPAEKDQYWDEDQPQP
PYTVATAAESLRPSFLGSTFNLRMSDDPEQSLQVEASPGSGRPAPAAQTPLLGRFLGVGA
PSPAISLRNFGRVRGTPRPPHLLRFRAEEGGDPEAAARIEEESAESGDEALEP
GenBank ID Protein 21734842
UniProtKB/Swiss-Prot ID Q8NFU0
UniProtKB/Swiss-Prot Entry Name BEST4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF440757
GeneCard ID BEST4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Tsunenari T, Sun H, Williams J, Cahill H, Smallwood P, Yau KW, Nathans J: Structure-function analysis of the bestrophin family of anion channels. J Biol Chem. 2003 Oct 17;278(42):41114-25. Epub 2003 Aug 7. [PubMed:12907679 ]
  4. Qu Z, Hartzell HC: Bestrophin Cl- channels are highly permeable to HCO3-. Am J Physiol Cell Physiol. 2008 Jun;294(6):C1371-7. doi: 10.1152/ajpcell.00398.2007. Epub 2008 Apr 9. [PubMed:18400985 ]
  5. Stohr H, Marquardt A, Nanda I, Schmid M, Weber BH: Three novel human VMD2-like genes are members of the evolutionary highly conserved RFP-TM family. Eur J Hum Genet. 2002 Apr;10(4):281-4. [PubMed:12032738 ]