Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07429
Secondary Accession Numbers
  • 13137
Name Prestin
Synonyms
  1. Solute carrier family 26 member 5
Gene Name SLC26A5
Protein Type Unknown
Biological Properties
General Function Involved in secondary active sulfate transmembrane transporter activity
Specific Function Motor protein that converts auditory stimuli to length changes in outer hair cells and mediates sound amplification in the mammalian hearing organ. Prestin is a bidirectional voltage- to-force converter, it can operate at microsecond rates. It uses cytoplasmic anions as extrinsic voltage sensors, probably chloride and bicarbonate. After binding to a site with millimolar affinity, these anions are translocated across the membrane in response to changes in the transmembrane voltage. They move towards the extracellular surface following hyperpolarization, and towards the cytoplasmic side in response to depolarization. As a consequence, this translocation triggers conformational changes in the protein that ultimately alter its surface area in the plane of the plasma membrane. The area decreases when the anion is near the cytoplasmic face of the membrane (short state), and increases when the ion has crossed the membrane to the outer surface (long state). So, it acts as an incomplete transporter. It swings anions across the membrane, but does not allow these anions to dissociate and escape to the extracellular space. Salicylate, an inhibitor of outer hair cell motility, acts as competitive antagonist at the prestin anion-binding site
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
inorganic anion transmembrane transporter activity
sulfate transmembrane transporter activity
secondary active sulfate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
anion transport
inorganic anion transport
sulfate transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7q22.1
SNPs SLC26A5
Gene Sequence
>2235 bp
ATGGATCATGCTGAAGAAAATGAAATCCTTGCAGCAACCCAGAGGTACTATGTGGAAAGG
CCTATCTTTAGTCATCCGGTCCTCCAGGAAAGACTACACACAAAGGACAAGGTTCCTGAT
TCCATTGCGGATAAGCTGAAACAGGCATTCACATGTACTCCTAAAAAAATAAGAAATATC
ATTTATATGTTCCTACCCATAACTAAATGGCTGCCAGCATACAAATTCAAGGAATATGTG
TTGGGTGACTTGGTCTCAGGCATAAGCACAGGGGTGCTTCAGCTTCCTCAAGGCTTAGCC
TTTGCAATGCTGGCAGCTGTGCCTCCAATATTTGGCCTGTACTCTTCATTTTACCCTGTT
ATCATGTATTGTTTTCTTGGAACCTCCAGACACATATCCATAGGTCCTTTTGCTGTTATT
AGCCTGATGATTGGTGGTGTAGCTGTTCGATTAGTACCAGATGATATAGTCATTCCAGGA
GGAGTAAATGCAACCAATGGCACAGAGGCCAGAGATGCCTTGAGAGTGAAAGTCGCCATG
TCTGTGACCTTACTTTCAGGAATCATTCAGTTTTGCCTAGGTGTCTGTAGGTTTGGATTT
GTGGCCATATATCTCACAGAGCCTCTGGTCCGTGGGTTTACCACCGCAGCAGCTGTGCAT
GTCTTCACCTCCATGTTAAAATATCTGTTTGGAGTTAAAACAAAGCGGTACAGTGGAATC
TTTTCCGTGGTGTATAGTACAGTTGCTGTGTTGCAGAATGTTAAAAACCTCAACGTGTGT
TCCCTAGGCGTCGGGCTGATGGTTTTTGGTTTGCTGTTGGGTGGCAAGGAGTTTAATGAG
AGATTTAAAGAGAAATTGCCGGCGCCTATTCCTTTAGAGTTCTTTGCGGTCGTAATGGGA
ACTGGCATTTCAGCTGGGTTTAACTTGAAAGAATCATACAATGTGGATGTCGTTGGAACA
CTTCCTCTAGGGCTGCTACCTCCAGCCAATCCGGACACCAGCCTCTTCCACCTTGTGTAC
GTAGATGCCATTGCCATAGCCATCGTTGGATTTTCAGTGACCATCTCCATGGCCAAGACC
TTAGCAAATAAACATGGCTACCAGGTTGACGGCAATCAGGAGCTCATTGCCCTGGGACTG
TGCAATTCCATTGGCTCACTCTTCCAGACCTTTTCAATTTCATGCTCCTTGTCTCGAAGC
CTTGTTCAGGAGGGAACCGGTGGGAAGACACAGCTTGCAGGTTGTTTGGCCTCATTAATG
ATTCTGCTGGTCATATTAGCAACTGGATTCCTCTTTGAATCATTGCCCCAGGCTGTGCTG
TCGGCCATTGTGATTGTCAACCTGAAGGGAATGTTTATGCAGTTCTCAGATCTCCCCTTT
TTCTGGAGAACCAGCAAAATAGAGCTGACCATCTGGCTTACCACTTTTGTGTCCTCCTTG
TTCCTGGGATTGGACTATGGTTTGATCACTGCTGTGATCATTGCTCTGCTGACTGTGATT
TACAGAACACAGAGTCCAAGCTACAAAGTCCTTGGAAAGCTTCCTGAAACTGATGTGTAT
ATTGATATAGACGCATATGAGGAGGTGAAAGAAATTCCTGGAATAAAAATATTTCAAATA
AATGCACCAATTTACTATGCAAATAGCGACTTGTATAGCAATGCATTAAAACGAAAGACT
GGAGTGAACCCAGCAGTCATCATGGGAGCAAGGAGAAAGGCCATGCGGAAGTACGCTAAG
GAAGTCGGAAATGCAAATATGGCCAACGCAACTGTTGTCAAAGCAGATGCAGAAGTAGAT
GGAGAGGATGCTACCAAGCCTGAAGAAGAGGATGGTGAAGTAAAATATCCCCCAATAGTG
ATCAAAAGCACATTTCCTGAGGAAATGCAAAGATTTATGCCCCCAGGGGATAACGTCCAC
ACTGTCATTTTGGATTTCACTCAAGTCAATTTTATTGATTCTGTTGGAGTGAAAACTCTG
GCAGGGATTGTAAAAGAATATGGAGACGTCGGTATATATGTATACTTAGCAGGATGCAGT
GCACAAGTTGTGAATGACCTCACTCGGAATAGATTTTTTGAAAATCCTGCCCTATGGGAG
CTGCTGTTCCACAGCATTCATGATGCAGTTTTAGGCAGCCAACTTAGAGAGGCACTTGCT
GAACAGGAAGCCTCGGCTCCCCCTTCCCAGGAGGACTTGGAGCCCAATGCCACTCCTGCC
ACTCCTGAGGCATAG
Protein Properties
Number of Residues 744
Molecular Weight 81263.0
Theoretical pI 6.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 80-100
  • 103-123
  • 132-152
  • 184-204
  • 212-232
  • 254-274
  • 287-307
  • 335-355
  • 375-395
  • 412-432
  • 442-462
  • 480-500
Protein Sequence
>Prestin
MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVD
GEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTL
AGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALA
EQEASAPPSQEDLEPNATPATPEA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P58743
UniProtKB/Swiss-Prot Entry Name S26A5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF523354
GeneCard ID SLC26A5
GenAtlas ID SLC26A5
HGNC ID HGNC:9359
References
General References
  1. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  2. Liu XZ, Ouyang XM, Xia XJ, Zheng J, Pandya A, Li F, Du LL, Welch KO, Petit C, Smith RJ, Webb BT, Yan D, Arnos KS, Corey D, Dallos P, Nance WE, Chen ZY: Prestin, a cochlear motor protein, is defective in non-syndromic hearing loss. Hum Mol Genet. 2003 May 15;12(10):1155-62. [PubMed:12719379 ]