You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07438
Secondary Accession Numbers
  • 13146
Name Anoctamin-10
Synonyms
  1. Transmembrane protein 16K
Gene Name ANO10
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function May act as a calcium-activated chloride channel
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:3
Locus 3p22.1
SNPs ANO10
Gene Sequence
>1983 bp
ATGAAAGTGACCTTATCAGCTTTGGATACTTCTGAGAGTTCTTTCACACCTTTGGTGGTC
ATAGAACTTGCTCAGGATGTCAAAGAAGAAACCAAAGAATGGCTGAAAAACAGAATTATA
GCTAAAAAAAAAGATGGAGGTGCCCAGTTGTTGTTTAGACCATTGTTAAATAAATATGAA
CAAGAAACACTAGAAAATCAGAACTTATATCTTGTTGGTGCCTCCAAGATTAGAATGTTA
CTAGGGGCAGAAGCAGTGGGATTGGTAAAAGAGTGCAATGATAACACCATGAGAGCCTTC
ACATACAGAACCAGACAGAACTTCAAAGGTTTTGATGATAACAATGATGATTTCCTGACA
ATGGCAGAATGTCAATTCATTATCAAACATGAACTTGAAAATCTTAGAGCTAAAGATGAA
AAAATGATCCCTGGTTACCCTCAGGCAAAGTTGTATCCAGGAAAATCATTGTTGAGAAGA
TTGCTCACGTCTGGCATCGTGATTCAGGTGTTTCCACTGCATGACAGTGAAGCCCTGAAG
AAGCTTGAGGACACCTGGTACACTCGGTTTGCTTTGAAGTATCAGCCCATAGACAGTATT
CGTGGCTACTTTGGGGAAACAATTGCTCTGTACTTTGGATTTTTGGAGTATTTCACTTTT
GCATTAATCCCCATGGCTGTCATTGGGTTACCTTACTACTTGTTTGTGTGGGAAGACTAT
GACAAGTACGTGATCTTTGCCTCGTTCAACCTCATCTGGTCCACGGTGATTCTGGAACTG
TGGAAGCGTGGCTGTGCCAACATGACCTACAGGTGGGGGACACTGCTCATGAAGAGAAAG
TTTGAGGAGCCCCGGCCAGGATTTCATGGTGTCTTGGGTATCAATTCCATCACTGGGAAG
GAGGAGCCTCTGTACCCCAGCTACAAGAGACAGTTGCGCATTTACCTGGTCTCCCTGCCA
TTCGTGTGCCTCTGCCTCTATTTCTCACTGTATGTCATGATGATTTACTTCGACATGGAG
GTTTGGGCCTTGGGTCTACATGAGAACAGCGGGTCTGAGTGGACCAGTGTCCTGTTGTAT
GTGCCCAGCATCATCTATGCCATTGTGATTGAGATCATGAATCGTCTCTATCGATATGCT
GCCGAGTTTTTAACTTCATGGGAGAATCACAGATTGGAATCTGCCTATCAGAACCATCTA
ATTCTGAAAGTTTTAGTGTTCAACTTCCTCAATTGCTTTGCCTCACTCTTCTATATTGCC
TTTGTCTTGAAAGATATGAAGCTTTTGCGCCAGAGCTTGGCCACTCTCCTAATTACCTCC
CAGATCCTCAACCAAATTATGGAATCTTTTCTTCCTTATTGGCTCCAAAGGAAGCATGGT
GTGCGGGTGAAGAGGAAGGTGCAGGCTTTAAAGGCAGACATTGATGCTACATTATATGAA
CAAGTCATCCTGGAAAAAGAAATGGGAACTTATTTGGGCACCTTTGATGATTACTTGGAG
TTATTCCTGCAGTTTGGTTATGTGAGCCTTTTCTCCTGTGTTTACCCATTAGCAGCTGCC
TTTGCTGTGTTAAATAACTTCACTGAAGTAAATTCAGATGCCTTAAAAATGTGCAGGGTC
TTCAAACGTCCATTCTCAGAACCTTCAGCCAATATTGGTGTGTGGCAGTTGGCTTTTGAA
ACGATGAGTGTTATATCTGTGGTCACTAACTGTGCGCTGATTGGAATGTCACCACAAGTG
AATGCAGTCTTTCCAGAATCAAAAGCAGACCTCATTTTGATTGTAGTAGCAGTGGAGCAC
GCACTCCTGGCTTTAAAGTTTATACTTGCATTTGCCATACCTGATAAGCCACGGCATATC
CAGATGAAACTAGCCAGACTGGAATTTGAGTCTTTGGAGGCACTCAAGCAGCAGCAAATG
AAGCTCGTGACCGAGAACCTGAAGGAGGAACCAATGGAAAGCGGGAAGGAGAAGGCAACC
TGA
Protein Properties
Number of Residues 660
Molecular Weight 76328.6
Theoretical pI 7.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 208-228
  • 241-261
  • 317-337
  • 353-373
  • 401-421
  • 501-521
  • 554-574
  • 591-611
Protein Sequence
>Anoctamin-10
MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYE
QETLENQNLYLVGASKIRMLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLT
MAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALK
KLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGK
EEPLYPSYKRQLRIYLVSLPFVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLY
VPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHLILKVLVFNFLNCFASLFYIA
FVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRV
FKRPFSEPSANIGVWQLAFETMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEH
ALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVTENLKEEPMESGKEKAT
GenBank ID Protein 94536803
UniProtKB/Swiss-Prot ID Q9NW15
UniProtKB/Swiss-Prot Entry Name ANO10_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_018075.3
GeneCard ID ANO10
GenAtlas ID ANO10
HGNC ID HGNC:25519
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  4. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]