Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07440
Secondary Accession Numbers
  • 13148
Name Anoctamin-2
Synonyms
  1. Transmembrane protein 16B
Gene Name ANO2
Protein Type Unknown
Biological Properties
General Function Involved in intracellular calcium activated chloride ch
Specific Function Acts as a calcium-activated chloride channel (CaCC), mostly in photoreceptors. May mediate olfactory amplification in olfactory sensory neurons (OSNs) and light perception amplification in retina
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13.3
SNPs ANO2
Gene Sequence
>3012 bp
ATGGCGACTCCCGGGCCGCGCGATATACCCCTGCTCCCTGGCTCCCCACGCCGGCTGAGC
CCTCAGGCAGGGTCCAGAGGGGGCCAGGGCCCCAAACATGGACAGCAGTGTCTCAAGATG
CCAGGTCCCCGGGCCCCAGGTCTGCAGGGCGGTTCCAACAGAGATCCTGGCCAGCCCTGC
GGTGGAGAGAGCACCCGCAGCAGCTCTGTCATCAACAACTATCTGGATGCCAATGAGCCT
GTGTCCTTGGAGGCCCGTCTTAGCCGCATGCACTTCCATGACAGTCAGAGGAAGGTCGAC
TATGTACTTGCCTACCACTACCGGAAACGCGGGGTGCACCTGGCCCAAGGCTTCCCTGGC
CACTCGCTGGCTATCGTCTCCAATGGGGAGACAGGCAAGGAGCCTCATGCTGGGGGCCCA
GGTGACATTGAGCTGGGACCGCTCGATGCCCTGGAGGAGGAGAGGAAGGAGCAGCGGGAG
GAATTTGAGCACAATCTGATGGAGGCTGGACTGGAGCTTGAGAAGGACTTGGAGAATAAA
AGCCAGGGATCCATCTTTGTCCGGATACACGCCCCGTGGCAGGTGCTGGCCAGAGAGGCA
GAATTCTTGAAGATCAAAGTTCCTACCAAGAAAGAGATGTACGAGATCAAAGCAGGAGGC
AGCATTGCAAAGAAGTTCAGCGCGGCTCTGCAGAAGCTGAGCTCGCACCTGCAGCCCCGA
GTTCCAGAACACAGCAACAACAAGATGAAAAACCTCTCCTACCCATTCTCCAGGGAGAAG
ATGTACCTGTACAACATCCAGGAAAAGGACACCTTCTTTGATAATGCCACCCGTAGCCGC
ATTGTGCACGAGATCCTGAAGCGCACAGCCTGCTCCCGAGCCAACAACACGATGGGTATT
AACTCTCTGATCGCAAACAATATCTATGAGGCTGCCTACCCTCTTCATGACGGTGAATAC
GATAGTCCAGAGGACGATATGAATGACAGGAAGCTGCTATATCAAGAATGGGCGCGCTAT
GGAGTGTTCTATAAGTTCCAACCTATTGACCTCATCAGAAAGTATTTTGGAGAAAAAATT
GGACTGTATTTTGCCTGGCTGGGATTATATACATCATTCCTCATCCCATCTTCTGTAATT
GGAGTGATTGTGTTTCTTTATGGATGTGCAACAATTGAAGAAGATATTCCCAGCAGAGAG
ATGTGTGACCAGCAGAATGCCTTCACCATGTGTCCCCTGTGTGACAAGTCCTGTGATTAC
TGGAACCTCAGCTCAGCCTGTGGGACCGCGCAGGCCAGCCACCTGTTTGACAACCCTGCC
ACCGTCTTCTTCTCTATCTTCATGGCTCTGTGGGCTACCATGTTCCTGGAAAACTGGAAG
AGGCTACAGATGCGACTGGGCTACTTTTGGGACCTGACTGGCATAGAAGAGGAAGAAGAA
CGTGCCCAGGAACATTCCAGGCCTGAGTATGAAACCAAAGTTCGAGAGAAAATGCTAAAG
GAGAGCAACCAGTCTGCTGTCCAGAAATTGGAAACAAACACGACGGAGTGTGGCGATGAG
GATGATGAAGATAAACTGACCTGGAAGGATCGTTTCCCAGGTTACCTGATGAACTTTGCC
TCCATCTTATTCATGATTGCCCTGACATTCTCAATCGTCTTTGGGGTGATAGTGTATCGA
ATAACAACTGCAGCCGCTCTGTCTCTCAATAAGGCTACACGCTCCAATGTCCGGGTGACA
GTGACAGCAACAGCAGTCATCATCAACCTCGTGGTCATCCTCATCCTGGACGAGATCTAC
GGCGCTGTGGCCAAGTGGCTCACCAAAATTGAGGTTCCGAAAACAGAACAGACTTTTGAA
GAGCGCCTGATCCTCAAAGCTTTCTTGCTCAAGTTTGTCAATGCCTACTCCCCCATCTTC
TATGTGGCCTTTTTCAAAGGGAGGTTTGTGGGCAGGCCTGGAAGCTACGTCTATGTATTC
GATGGTTACCGCATGGAAGAGTGTGCTCCAGGGGGCTGTCTCATGGAGCTCTGCATTCAG
CTCAGCATCATCATGTTGGGGAAGCAGTTGATCCAGAACAACATCTTTGAGATTGGAGTC
CCGAAGCTAAAGAAACTATTTCGAAAGCTGAAAGATGAGACCGAAGCTGGAGAAACTGAC
TCTGCCCATTCGAAACATCCAGAGCAGTGGGACCTAGACTACAGCTTGGAACCATACACA
GGACTGACTCCGGAGTACATGGAAATGATCATCCAGTTTGGTTTTGTCACCCTCTTCGTG
GCCTCCTTTCCCCTGGCACCTGTGTTTGCCCTCCTCAACAACGTCATTGAAGTGCGGCTC
GATGCAAAGAAGTTTGTTACAGAGCTGAGACGGCCGGATGCTGTAAGAACCAAAGATATC
GGAATCTGGTTTGACATTCTCTCTGGAATTGGCAAGTTCTCTGTTATCAGCAACGCTTTT
GTCATTGCGATCACCTCCGACTTTATCCCCCGCCTGGTGTACCAGTACTCCTACAGTCAC
AATGGGACTCTGCACGGCTTTGTCAACCACACCCTCTCCTTTTTCAACGTCAGCCAGCTG
AAGGAGGGGACGCAGCCAGAAAACTCACAGTTTGACCAGGAGGTTCAGTTCTGCAGGTTT
AAGGATTACCGAGAGCCGCCATGGGCCCCGAACCCTTATGAGTTTTCGAAACAGTACTGG
TTTATTCTGTCTGCCCGTCTGGCTTTTGTCATAATCTTCCAGAACCTCGTGATGTTCCTG
AGCGTCCTCGTGGACTGGATGATTCCAGACATCCCCACGGACATCAGCGACCAGATCAAG
AAAGAGAAGAGCTTATTAGTGGATTTCTTCCTGAAAGAGGAGCATGAGAAGCTCAAGCTG
ATGGATGAGCCGGCTCTGAGGAGCCCAGGAGGTGGGGATCGAAGCAGGAGCCGGGCAGCC
AGCTCAGCACCTTCAGGCCAAAGCCAGCTGGGCAGCATGATGTCGTCAGGCTCTCAGCAC
ACCAATGTGTGA
Protein Properties
Number of Residues 1003
Molecular Weight 113968.4
Theoretical pI 6.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 366-386
  • 435-455
  • 539-559
  • 583-603
  • 624-644
  • 749-769
  • 802-822
  • 908-928
Protein Sequence
>Anoctamin-2
MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPC
GGESTRSSSVINNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPG
HSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENK
SQGSIFVRIHAPWQVLAREAEFLKIKVPTKKEMYEIKAGGSIAKKFSAALQKLSSHLQPR
VPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRIVHEILKRTACSRANNTMGI
NSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKI
GLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEE
RAQEHSRPEYETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFA
SILFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIY
GAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVF
DGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRKLKDETEAGETD
SAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRL
DAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYW
FILSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKL
MDEPALRSPGGGDRSRSRAASSAPSGQSQLGSMMSSGSQHTNV
GenBank ID Protein 219809115
UniProtKB/Swiss-Prot ID Q9NQ90
UniProtKB/Swiss-Prot Entry Name ANO2_HUMAN
PDB IDs Not Available
GenBank Gene ID FJ384095
GeneCard ID ANO2
GenAtlas ID ANO2
HGNC ID HGNC:1183
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]
  3. Stohr H, Heisig JB, Benz PM, Schoberl S, Milenkovic VM, Strauss O, Aartsen WM, Wijnholds J, Weber BH, Schulz HL: TMEM16B, a novel protein with calcium-dependent chloride channel activity, associates with a presynaptic protein complex in photoreceptor terminals. J Neurosci. 2009 May 27;29(21):6809-18. doi: 10.1523/JNEUROSCI.5546-08.2009. [PubMed:19474308 ]