Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07441
Secondary Accession Numbers
  • 13149
Name Anoctamin-3
Synonyms
  1. Transmembrane protein 16C
Gene Name ANO3
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function May act as a calcium-activated chloride channel
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 11p14.2
SNPs ANO3
Gene Sequence
>2946 bp
ATGGTCCACCATTCAGGCTCCATTCAGTCCTTTAAACAGCAAAAAGGTATGAATATAAGC
AAGAGTGAGATAACAAAAGAAACTTCGTTAAAACCGTCTCGGAGATCCCTGCCTTGCCTC
GCCCAGAGCTACGCTTACTCAAAGAGCTTGAGCCAGTCTACTTCCCTCTTCCAGTCAACC
GAGAGTGAATCTCAGGCTCCCACATCTATAACCTTAATCTCCACTGACAAAGCAGAGCAA
GTTAATACTGAGGAGAATAAAAACGACTCTGTGCTGAGATGTTCATTTGCTGACCTCAGC
GATTTTTGTTTGGCCCTAGGAAAAGATAAGGATTACACGGATGAATCAGAACACGCTACT
TATGACCGATCTCGTCTCATTAATGACTTTGTTATCAAAGATAAATCTGAATTCAAGACA
AAATTATCTAAGAATGACATGAATTACATAGCATCCAGTGGACCTCTGTTCAAAGATGGC
AAAAAGAGAATTGATTACATCTTGGTTTATAGAAAGACAAATATACAATATGATAAAAGA
AACACATTTGAAAAGAACCTCAGAGCAGAAGGCTTGATGTTGGAGAAGGAGCCAGCTATT
GCAAGCCCCGATATCATGTTTATTAAAATTCACATTCCATGGGACACGCTGTGCAAGTAT
GCAGAGAGGCTGAATATCAGGATGCCCTTCAGGAAAAAATGCTATTACACTGACGGGAGG
AGCAAATCAATGGGCAGGATGCAAACTTATTTTAGAAGAATCAAAAACTGGATGGCCCAA
AACCCAATGGTTCTTGACAAGTCAGCTTTTCCAGACCTAGAGGAGTCAGACTGCTATACT
GGCCCCTTCAGCCGTGCACGGATTCACCACTTCATAATAAATAATAAAGACACCTTCTTC
AGCAATGCTACTCGAAGCAGAATAGTCTATCACATGCTGGAACGCACCAAATATGAAAAT
GGAATATCAAAAGTGGGTATCCGTAAACTTATAAACAATGGCTCATACATAGCAGCGTTT
CCACCACATGAGGGAGCCTACAAAAGTAGCCAGCCCATTAAAACCCATGGACCTCAGAAT
AACAGACATCTATTATATGAGCGCTGGGCACGCTGGGGAATGTGGTATAAGCATCAGCCT
CTGGATTTAATCAGGCTATACTTTGGTGAGAAGATTGGACTATACTTTGCTTGGCTGGGA
TGGTATACTGGAATGTTGATTCCTGCAGCAATTGTTGGTTTGTGCGTTTTCTTCTATGGA
TTATTTACAATGAATAATAGTCAAGTAAGCCAAGAAATTTGTAAAGCCACTGAAGTCTTT
ATGTGCCCTCTCTGTGACAAGAACTGCTCCCTGCAGAGACTCAACGACAGCTGTATCTAT
GCCAAGGTGACATATTTGTTCGATAATGGAGGGACAGTCTTCTTTGCTATTTTTATGGCA
ATATGGGCCACAGTCTTCCTGGAGTTTTGGAAAAGGAGAAGGAGTATACTGACCTATACT
TGGGACCTTATCGAATGGGAAGAAGAGGAGGAAACACTTCGTCCCCAGTTTGAAGCCAAG
TATTACAAGATGGAGATTGTAAATCCCATCACGGGAAAACCTGAACCACATCAGCCTTCC
TCAGACAAAGTCACTCGTCTTCTTGTTTCTGTCTCAGGAATATTCTTCATGATATCCTTG
GTGATCACTGCAGTGTTTGGAGTTGTGGTGTACCGCCTGGTTGTCATGGAACAGTTTGCA
TCATTCAAGTGGAATTTCATCAAACAATACTGGCAGTTTGCAACATCTGCTGCTGCTGTC
TGTATCAATTTCATAATCATTATGTTGCTGAATCTTGCTTATGAAAAAATTGCTTACCTC
CTCACCAATTTAGAATATCCTCGAACAGAATCAGAGTGGGAAAACAGCTTCGCCCTGAAG
ATGTTCCTCTTCCAGTTTGTCAATTTAAACAGTTCCATCTTCTATATCGCTTTCTTTTTG
GGAAGATTCGTAGGCCACCCAGGAAAATACAATAAACTTTTTGACCGGTGGAGACTGGAG
GAATGTCATCCTAGTGGCTGTTTGATAGACCTCTGCCTCCAGATGGGTGTCATCATGTTT
TTGAAGCAAATATGGAACAACTTCATGGAACTAGGATACCCGTTGATCCAGAACTGGTGG
TCACGACATAAAATCAAGCGGGGAATACATGATGCTTCCATACCTCAGTGGGAAAATGAT
TGGAATCTGCAGCCCATGAACCTTCATGGACTGATGGATGAGTACTTAGAAATGGTTTTG
CAATTTGGTTTTACCACCATCTTTGTTGCGGCTTTTCCTCTAGCCCCTCTTTTGGCTTTG
TTAAACAATATCATTGAAATCAGGCTGGATGCATACAAATTTGTCACTCAATGGCGGAGG
CCTTTGCCAGCCCGAGCAACTGACATAGGTATCTGGCTTGGAATTCTCGAAGGAATCGGT
ATATTGGCTGTGATCACCAATGCATTTGTAATTGCTATTACTTCTGATTACATCCCACGT
TTTGTTTATGAATACAAATATGGCCCCTGTGCAAATCATGTAGAACCAAGTGAAAATTGC
TTGAAGGGATATGTCAACAATAGCCTATCCTTCTTTGACCTGAGTGAGCTTGGTATGGGA
AAATCTGGTTATTGCAGGTACAGAGACTACAGAGGCCCGCCCTGGAGTTCCAAACCCTAT
GAGTTTACTTTACAATACTGGCATATCCTTGCTGCTAGATTGGCCTTCATTATTGTGTTT
GAGCACCTTGTTTTTGGGATTAAGTCATTCATCGCATACCTGATTCCAGACGTACCAAAG
GGTCTACATGACCGAATACGACGAGAGAAGTACTTAGTTCAAGAAATGATGTATGAGGCT
GAACTGGAACATTTGCAACAACAACGGAGAAAAAGTGGTCAGCCTGTTCACCATGAATGG
CCTTAG
Protein Properties
Number of Residues 981
Molecular Weight 114655.5
Theoretical pI 8.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 404-424
  • 470-490
  • 551-571
  • 593-613
  • 641-661
  • 762-782
  • 811-831
  • 915-935
Protein Sequence
>Anoctamin-3
MVHHSGSIQSFKQQKGMNISKSEITKETSLKPSRRSLPCLAQSYAYSKSLSQSTSLFQST
ESESQAPTSITLISTDKAEQVNTEENKNDSVLRCSFADLSDFCLALGKDKDYTDESEHAT
YDRSRLINDFVIKDKSEFKTKLSKNDMNYIASSGPLFKDGKKRIDYILVYRKTNIQYDKR
NTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGR
SKSMGRMQTYFRRIKNWMAQNPMVLDKSAFPDLEESDCYTGPFSRARIHHFIINNKDTFF
SNATRSRIVYHMLERTKYENGISKVGIRKLINNGSYIAAFPPHEGAYKSSQPIKTHGPQN
NRHLLYERWARWGMWYKHQPLDLIRLYFGEKIGLYFAWLGWYTGMLIPAAIVGLCVFFYG
LFTMNNSQVSQEICKATEVFMCPLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMA
IWATVFLEFWKRRRSILTYTWDLIEWEEEEETLRPQFEAKYYKMEIVNPITGKPEPHQPS
SDKVTRLLVSVSGIFFMISLVITAVFGVVVYRLVVMEQFASFKWNFIKQYWQFATSAAAV
CINFIIIMLLNLAYEKIAYLLTNLEYPRTESEWENSFALKMFLFQFVNLNSSIFYIAFFL
GRFVGHPGKYNKLFDRWRLEECHPSGCLIDLCLQMGVIMFLKQIWNNFMELGYPLIQNWW
SRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFVAAFPLAPLLAL
LNNIIEIRLDAYKFVTQWRRPLPARATDIGIWLGILEGIGILAVITNAFVIAITSDYIPR
FVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSELGMGKSGYCRYRDYRGPPWSSKPY
EFTLQYWHILAARLAFIIVFEHLVFGIKSFIAYLIPDVPKGLHDRIRREKYLVQEMMYEA
ELEHLQQQRRKSGQPVHHEWP
GenBank ID Protein 156766084
UniProtKB/Swiss-Prot ID Q9BYT9
UniProtKB/Swiss-Prot Entry Name ANO3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031418.2
GeneCard ID ANO3
GenAtlas ID ANO3
HGNC ID HGNC:14004
References
General References
  1. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  2. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]