You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07442
Secondary Accession Numbers
  • 13150
Name Anoctamin-4
Synonyms
  1. Transmembrane protein 16D
Gene Name ANO4
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function May act as a calcium-activated chloride channel
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 12q23.1
SNPs ANO4
Gene Sequence
>2868 bp
ATGGAGGCAAGCTCTTCTGGAATCACTAATGGAAAAACCAAAGTCTTCCACCCAGAAGGA
GGTGTGGATTTGCAAGGCTACCAGCTGGATATGCAAATACTACCTGACGGGCCAAAGAGT
GATGTGGACTTTTCAGAGATTCTTAATGCAATACAAGAAATGGCCAAGGATGTCAATATT
CTTTTTGATGAATTAGAAGCTGTCAGCAGTCCTTGCAAAGATGACGATTCTCTTCTTCAC
CCTGGAAACCTGACTAGTACTTCAGATGATGCCAGCAGATTGGAAGCCGGGGGAGAGACA
GTGCCAGAAAGAAACAAATCAAATGGACTTTACTTTCGAGATGGAAAGTGTCGAATTGAC
TACATCCTTGTGTACAGAAAATCCAACCCCCAGACTGAAAAGAGAGAAGTATTTGAAAGA
AACATTAGAGCAGAAGGATTGCAAATGGAGAAAGAGTCCTCTCTAATAAATAGTGACATT
ATCTTTGTGAAGTTGCATGCCCCATGGGAAGTCCTTGGAAGATATGCAGAACAAATGAAT
GTAAGAATGCCTTTCAGGAGAAAAATCTATTACCTGCCCCGCCGTTACAAGTTCATGAGC
AGGATCGATAAACAAATAAGCAGGTTTCGGAGATGGTTACCTAAGAAGCCAATGAGGCTG
GACAAGGAGACACTGCCAGACCTGGAGGAGAATGACTGCTACACTGCCCCTTTCAGCCAG
CAAAGGATCCATCACTTCATCATACACAACAAAGAAACGTTCTTCAACAATGCCACAAGA
AGTAGAATCGTGCATCACATTTTACAAAGAATAAAATATGAAGAAGGAAAAAACAAGATT
GGTCTGAATCGTTTGCTTACCAATGGCTCCTATGAAGCTGCGTTTCCCCTGCATGAGGGA
AGTTATAGAAGTAAAAACTCCATTCGAACCCATGGAGCAGAAAACCACCGACATCTACTC
TATGAGTGCTGGGCCTCCTGGGGCGTGTGGTATAAATACCAACCTTTGGATCTTGTAAGG
CGGTACTTTGGAGAGAAGATTGGGTTATATTTTGCCTGGTTGGGCTGGTACACCGGCATG
CTCTTCCCAGCTGCCTTCATTGGATTGTTTGTCTTTTTGTATGGCGTCACCACTCTGGAT
CACAGCCAAGTCAGTAAAGAAGTCTGCCAAGCTACAGATATCATCATGTGTCCTGTGTGT
GATAAATACTGTCCATTCATGAGGCTGTCAGACAGCTGTGTATATGCCAAGGTAACCCAC
CTTTTTGACAATGGAGCCACTGTCTTCTTTGCTGTTTTCATGGCAGTCTGGGCAACAGTT
TTCCTGGAGTTTTGGAAAAGACGGCGAGCAGTAATTGCTTATGACTGGGATTTGATAGAC
TGGGAAGAAGAGGAGGAAGAAATACGACCCCAGTTTGAAGCCAAGTATTCCAAGAAAGAG
CGGATGAATCCAATTTCTGGAAAGCCAGAACCTTATCAAGCATTTACAGATAAATGCAGC
AGACTTATCGTTTCTGCATCTGGAATATTTTTTATGATCTGCGTGGTGATTGCTGCCGTG
TTCGGGATCGTCATTTACCGGGTGGTGACTGTCAGCACTTTCGCTGCCTTTAAGTGGGCG
TTAATCAGGAATAACTCTCAGGTTGCAACCACAGGGACTGCTGTGTGCATCAACTTCTGT
ATCATTATGTTGCTGAATGTGCTCTATGAAAAAGTTGCCCTGCTTCTGACGAATTTAGAA
CAGCCTCGCACAGAGTCTGAGTGGGAGAACAGCTTCACCCTGAAAATGTTTCTTTTTCAG
TTTGTCAATCTGAACAGCTCCACATTTTACATCGCATTCTTCCTCGGAAGATTTACAGGA
CACCCAGGTGCCTACTTGAGGCTGATAAACAGGTGGAGACTAGAAGAGTGCCACCCTAGT
GGATGCCTTATTGATCTGTGTATGCAAATGGGTATTATAATGGTGCTAAAGCAGACCTGG
AATAATTTCATGGAACTTGGCTACCCGTTAATTCAGAATTGGTGGACTAGAAGAAAAGTA
CGACAAGAACATGGACCTGAAAGGAAAATAAGTTTCCCACAATGGGAAAAGGACTATAAC
CTTCAGCCGATGAATGCCTATGGACTCTTCGATGAATACTTAGAAATGATTCTTCAGTTT
GGATTCACAACTATCTTTGTGGCAGCTTTTCCCCTAGCACCACTTCTGGCCTTACTGAAT
AACATAATTGAAATTCGACTTGATGCTTACAAATTTGTCACACAGTGGAGGAGACCTTTA
GCTTCAAGGGCCAAAGACATAGGAATTTGGTATGGAATTCTTGAAGGCATTGGAATTCTC
TCTGTTATCACAAATGCATTTGTCATAGCGATAACATCTGACTTTATCCCTCGCTTGGTG
TATGCTTATAAGTATGGACCTTGTGCAGGCCAAGGAGAAGCTGGGCAAAAGTGCATGGTT
GGCTATGTGAATGCCAGCTTGTCTGTATTTCGAATTTCTGACTTTGAGAACCGATCTGAG
CCTGAATCTGATGGCAGTGAGTTCTCGGGGACTCCTCTTAAGTACTGCAGATACCGGGAC
TACCGTGACCCGCCTCATTCACTGGTGCCCTATGGCTACACACTGCAGTTTTGGCATGTC
CTAGCTGCTCGATTAGCTTTTATCATTGTCTTTGAGCACCTCGTGTTTTGTATAAAGCAC
CTCATTTCATATCTGATCCCAGACCTCCCAAAAGACCTAAGGGATCGAATGAGAAGAGAG
AAGTACTTGATTCAGGAGATGATGTATGAAGCAGAACTGGAACGTCTCCAGAAGGAACGA
AAGGAGAGGAAGAAGAATGGAAAAGCACACCACAACGAGTGGCCGTGA
Protein Properties
Number of Residues 955
Molecular Weight 111460.6
Theoretical pI 8.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 353-373
  • 425-445
  • 506-526
  • 548-568
  • 596-616
  • 716-736
  • 769-789
  • 886-906
Protein Sequence
>Anoctamin-4
MEASSSGITNGKTKVFHPEGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEMAKDVNI
LFDELEAVSSPCKDDDSLLHPGNLTSTSDDASRLEAGGETVPERNKSNGLYFRDGKCRID
YILVYRKSNPQTEKREVFERNIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMN
VRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEENDCYTAPFSQ
QRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKIGLNRLLTNGSYEAAFPLHEG
SYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGM
LFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPVCDKYCPFMRLSDSCVYAKVTH
LFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKE
RMNPISGKPEPYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWA
LIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQ
FVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTW
NNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKDYNLQPMNAYGLFDEYLEMILQF
GFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGIL
SVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSE
PESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKH
LISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKERKKNGKAHHNEWP
GenBank ID Protein 80478369
UniProtKB/Swiss-Prot ID Q32M45
UniProtKB/Swiss-Prot Entry Name ANO4_HUMAN
PDB IDs Not Available
GenBank Gene ID BC109308
GeneCard ID ANO4
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]
  4. Katoh M, Katoh M: FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products. Int J Oncol. 2003 Jun;22(6):1375-81. [PubMed:12739008 ]