Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07444
Secondary Accession Numbers
  • 13152
Name Anoctamin-6
Synonyms
  1. Transmembrane protein 16F
Gene Name ANO6
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function May act as a calcium-activated chloride channel
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 12q12
SNPs ANO6
Gene Sequence
>2733 bp
ATGAAAAAGATGAGCAGGAATGTTTTGCTACAAATGGAGGAGGAGGAGGACGACGACGAT
GGGGATATCGTGTTGGAAAACCTTGGACAGACAATTGTCCCCGATTTGGGATCACTGGAA
AGTCAGCATGATTTTCGAACCCCGGAGTTTGAAGAATTTAATGGAAAACCTGACTCCCTC
TTTTTTAATGATGGCCAGCGAAGAATTGACTTTGTTCTAGTATATGAGGATGAAAGCAGA
AAAGAGACCAATAAAAAGGGTACAAATGAAAAACAAAGGAGGAAAAGACAAGCATACGAA
TCTAACCTTATCTGTCATGGCCTGCAGTTAGAAGCAACAAGATCAGTATTGGATGACAAG
CTTGTATTTGTAAAAGTACACGCACCATGGGAGGTGTTATGTACGTATGCTGAGATAATG
CACATCAAATTGCCTCTGAAACCCAATGATCTGAAAAACCGGTCCTCAGCCTTTGGTACA
CTCAACTGGTTTACCAAAGTCCTCAGTGTAGACGAAAGCATCATCAAGCCAGAGCAAGAG
TTTTTCACTGCCCCATTTGAGAAGAACCGGATGAATGATTTTTACATAGTTGATAGAGAT
GCTTTCTTCAATCCAGCCACCAGAAGCCGCATTGTTTACTTCATCCTCTCTCGGGTCAAG
TATCAAGTGATAAACAATGTTAGCAAGTTTGGGATCAACAGACTTGTAAACTCTGGGATC
TACAAGGCAGCTTTCCCACTCCATGATTGCAAATTCCGCCGTCAGTCAGAGGATCCCAGC
TGCCCTAATGAACGGTACCTTCTGTACAGAGAATGGGCTCATCCTCGAAGCATATACAAA
AAGCAGCCCTTGGATCTTATCAGGAAATACTATGGAGAGAAGATTGGAATCTACTTTGCT
TGGCTGGGCTATTACACTCAGATGCTTCTCCTGGCCGCAGTTGTAGGAGTGGCTTGCTTT
CTCTATGGATATCTTAATCAAGATAACTGTACATGGAGCAAAGAAGTTTGTCATCCTGAT
ATTGGTGGCAAGATCATAATGTGTCCTCAGTGTGATAGGCTTTGTCCATTCTGGAAACTC
AATATTACTTGCGAGTCCTCAAAGAAATTGTGCATCTTCGACAGTTTTGGAACCCTGGTC
TTTGCAGTATTTATGGGAGTATGGGTTACCTTGTTTTTGGAGTTTTGGAAGCGACGCCAG
GCAGAACTTGAGTATGAATGGGATACTGTTGAGTTACAGCAGGAAGAACAAGCCCGACCA
GAATACGAAGCACGATGTACTCACGTAGTGATAAATGAGATTACTCAGGAAGAAGAACGC
ATTCCCTTTACTGCCTGGGGAAAATGTATACGGATAACCCTCTGTGCCAGTGCTGTCTTT
TTCTGGATCCTATTGATCATCGCTTCAGTTATTGGGATCATTGTCTATAGGCTCTCGGTG
TTCATTGTATTTTCTGCAAAACTTCCCAAGAACATTAATGGAACAGACCCAATCCAGAAA
TACCTGACTCCACAGACAGCCACGTCCATCACGGCCTCCATCATCAGCTTTATAATTATC
ATGATTCTGAACACCATATATGAAAAAGTGGCAATTATGATTACTAACTTCGAACTCCCA
AGGACCCAGACTGATTATGAGAACAGCCTCACCATGAAGATGTTCTTATTCCAGTTTGTC
AACTACTACTCTTCATGCTTCTACATAGCATTCTTTAAGGGCAAATTTGTAGGCTATCCA
GGAGACCCAGTTTATTGGTTGGGAAAATACAGAAATGAAGAGTGTGACCCAGGTGGCTGT
CTTCTTGAACTGACAACTCAGCTGACAATAATCATGGGAGGAAAAGCAATCTGGAATAAC
ATACAAGAAGTATTATTGCCCTGGATCATGAATCTAATTGGGCGATTTCACAGAGTTTCT
GGATCAGAAAAGATAACCCCACGATGGGAACAGGACTACCATCTGCAGCCTATGGGCAAA
CTGGGATTATTTTATGAATATCTTGAAATGATTATTCAGTTTGGGTTCGTCACCTTATTT
GTGGCCTCTTTTCCACTGGCCCCTCTGTTGGCTCTCGTGAACAATATATTGGAAATAAGA
GTGGACGCATGGAAACTGACCACCCAGTTTAGACGCCTGGTACCAGAGAAAGCCCAAGAC
ATTGGAGCATGGCAGCCCATCATGCAAGGAATAGCAATTCTGGCTGTGGTGACCAATGCC
ATGATCATAGCTTTCACGTCGGACATGATCCCCCGCCTAGTGTACTACTGGTCCTTCTCC
GTCCCTCCCTACGGGGACCACACTTCCTACACCATGGAAGGGTACATCAACAACACTCTC
TCCATCTTCAAAGTCGCAGACTTCAAAAACAAAAGCAAGGGAAACCCGTACTCTGACCTG
GGTAACCATACCACATGCAGGTATCGTGATTTCCGATACCCACCTGGACACCCCCAGGAG
TATAAACACAACATCTACTATTGGCATGTGATTGCAGCCAAGCTGGCTTTTATCATTGTC
ATGGAGCACGTCATCTACTCTGTGAAATTTTTCATTTCATATGCAATTCCCGATGTATCA
AAACGCACAAAGAGCAAGATCCAGAGAGAAAAATACCTAACCCAAAAGCTTCTTCATGAG
AATCACCTCAAAGATATGACGAAAAATATGGGGGTGATAGCTGAGCGGATGATAGAAGCA
GTAGATAACAATTTACGGCCAAAATCAGAATAA
Protein Properties
Number of Residues 910
Molecular Weight 106164.1
Theoretical pI 7.83
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 295-315
  • 376-396
  • 455-475
  • 514-534
  • 552-572
  • 670-690
  • 726-746
  • 825-845
Protein Sequence
>Anoctamin-6
MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSL
FFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDK
LVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQE
FFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGI
YKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA
WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQCDRLCPFWKL
NITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP
EYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSV
FIVFSAKLPKNINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELP
RTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC
LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWEQDYHLQPMGK
LGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQD
IGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSYTMEGYINNTL
SIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
MEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA
VDNNLRPKSE
GenBank ID Protein 218156299
UniProtKB/Swiss-Prot ID Q4KMQ2
UniProtKB/Swiss-Prot Entry Name ANO6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001025356.2
GeneCard ID ANO6
GenAtlas ID ANO6
HGNC ID HGNC:25240
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]
  6. Katoh M, Katoh M: Identification and characterization of TMEM16E and TMEM16F genes in silico. Int J Oncol. 2004 May;24(5):1345-9. [PubMed:15067359 ]