Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07445
Secondary Accession Numbers
  • 13153
Name Anoctamin-7
Synonyms
  1. D-TMPP
  2. Dresden transmembrane protein of the prostate
  3. IPCA-5
  4. New gene expressed in prostate
  5. Prostate cancer-associated protein 5
  6. Transmembrane protein 16G
Gene Name ANO7
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function May act as a calcium-activated chloride channel. May play a role in cell-cell interactions
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Isoform 2:Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location Chromosome:2
Locus 2q37.3
SNPs ANO7
Gene Sequence
>2802 bp
ATGCGAATGGCTGCCACTGCCTGGGCGGGGCTCCAAGGGCCACCCCTCCCCACCCTCTGT
CCCGCAGTGAGGACGGGACTCTACTGCCGAGACCAGGCTCACGCTGAGAGGTGGGCCATG
ACCTCCGAGACCTCTTCCGGAAGCCACTGTGCCAGGAGCAGGATGCTGCGGCGACGGGCC
CAGGAAGAGGACAGCACCGTCCTGATCGATGTGAGCCCCCCTGAGGCAGAGAAGAGGGGC
TCTTACGGGAGCACAGCCCACGCCTCGGAGCCAGGTGGACAGCAAGCGGCCGCCTGCAGA
GCTGGGAGTCCTGCCAAGCCCCGGATCGCAGACTTCGTCCTCGTTTGGGAGGAGGACCTG
AAGCTAGACAGGCAGCAGGACAGTGCCGCCCGGGACAGAACAGACATGCACAGGACCTGG
CGGGAGACTTTTCTGGATAATCTTCGTGCGGCTGGGCTGTGTGTAGACCAGCAGGACGTC
CAGGACGGGAACACCACAGTGCACTACGCCCTCCTCAGCGCCTCCTGGGCTGTGCTCTGC
TACTACGCCGAAGACCTGCGCCTGAAGCTGCCCTTGCAGGAGTTACCCAACCAGGCCTCC
AACTGGTCGGCCGGCCTGCTGGCATGGCTGGGCATCCCCAACGTCCTGCTGGAGGTTGTG
CCAGACGTACCCCCCGAGTACTACTCCTGCCGGTTCAGAGTGAACAAGCTGCCACGCTTC
CTCGGGAGTGACAACCAGGACACCTTCTTCACAAGCACCAAGAGGCACCAAATTCTGTTT
GAGATCCTGGCCAAGACCCCGTATGGCCACGAGAAGAAAAACCTGCTTGGGATCCACCAG
CTGCTGGCAGAGGGTGTCCTCAGTGCCGCCTTCCCCCTGCATGACGGCCCCTTCAAGACG
CCCCCAGAGGGCCCGCAGGCTCCACGCCTCAACCAGCGCCAAGTCCTTTTCCAGCACTGG
GCGCGCTGGGGCAAGTGGAACAAGTACCAGCCCCTGGACCACGTGCGCAGGTACTTCGGG
GAGAAGGTGGCCCTCTACTTCGCCTGGCTCGGGTTTTACACAGGCTGGCTCCTGCCAGCG
GCAGTGGTGGGCACACTGGTGTTCCTGGTGGGCTGCTTCCTGGTGTTCTCAGACATACCC
ACGCAGGAACTGTGTGGCAGCAAGGACAGCTTCGAGATGTGCCCACTTTGCCTCGACTGC
CCTTTCTGGCTGCTCTCCAGCGCCTGTGCCCTGGCCCAGGCCGGCCGGCTGTTCGACCAC
GGCGGCACCGTGTTCTTCAGCTTGTTCATGGCACTGTGGGCCGTGCTGCTGCTGGAGTAC
TGGAAGCGGAAGAGCGCCACGCTGGCCTACCGCTGGGACTGCTCTGACTACGAGGACACT
GAGGAGAGGCCTCGGCCCCAGTTTGCCGCCTCAGCCCCCATGACAGCCCCGAACCCCATC
ACGGGTGAGGACGAGCCCTACTTCCCTGAGAGGAGCCGCGCGCGCCGCATGCTGGCCGGC
TCTGTGGTGATCGTGGTGATGGTGGCCGTGGTGGTCATGTGCCTCGTGTCTATCATCCTG
TACCGTGCCATCATGGCCATCGTGGTGTCCAGGTCGGGCAACACCCTTCTCGCAGCCTGG
GCCTCTCGCATCGCCAGCCTCACGGGGTCTGTAGTGAACCTCGTCTTCATCCTCATCCTC
TCCAAGATCTATGTATCCCTGGCCCACGTCCTGACACGATGGGAAATGCACCGCACCCAG
ACCAAGTTCGAGGACGCCTTCACCCTCAAGGTGTTCATCTTCCAGTTCGTCAACTTCTAC
TCCTCACCCGTCTACATTGCCTTCTTCAAGGGCAGGTTTGTGGGATACCCAGGCAACTAC
CACACCTTGTTTGGAGTCCGCAATGAGGAGTGCGCGGCTGGAGGCTGCCTGATCGAGCTG
GCACAGGAGCTCCTGGTCATCATGGTGGGCAAGCAGGTCATCAACAACATGCAGGAGGTC
CTCATCCCGAAGCTAAAGGGCTGGTGGCAGAAGTTCCGGCTTCGCTCCAAGAAGAGGAAG
GCGGGAGCTTCTGCAGGGGCTAGCCAGGGGCCCTGGGAGGACGACTATGAGCTTGTGCCC
TGTGAGGGTCTGTTTGACGAGTACCTGGAAATGGTGCTGCAGTTCGGCTTCGTCACCATC
TTCGTGGCCGCCTGTCCGCTCGCGCCGCTCTTCGCCCTGCTCAACAACTGGGTGGAGATC
CGCTTGGACGCGCGCAAGTTCGTCTGCGAGTACCGGCGCCCTGTGGCCGAGCGCGCCCAG
GACATCGGCATCTGGTTCCACATCCTGGCGGGCCTCACGCACCTGGCGGTCATCAGCAAC
GCCTTCCTCCTGGCCTTCTCGTCCGACTTCCTGCCGCGCGCCTACTACCGGTGGACCCGC
GCCCACGACCTGCGCGGCTTCCTCAACTTCACGCTGGCGCGAGCCCCGTCCTCCTTCGCC
GCCGCGCACAACCGCACGTGCAGGTATCGGGCTTTCCGGGATGACGATGGACATTATTCC
CAGACCTACTGGAATCTTCTTGCCATCCGCCTGGCCTTCGTCATTGTGTTTGAGCATGTG
GTTTTCTCCGTTGGCCGCCTCCTGGACCTCCTGGTGCCTGACATCCCAGAGTCTGTGGAG
ATCAAAGTGAAGCGGGAGTACTACCTGGCTAAGCAGGCACTGGCTGAGAATGAGGTTCTT
TTTGGAACGAACGGAACAAAGGATGAGCAGCCCAAGGGCTCAGAGCTCAGCTCCCACTGG
ACACCCTTCACGGTTCCCAAGGCCAGCCAGCTGCAGCAGTGA
Protein Properties
Number of Residues 933
Molecular Weight 105529.5
Theoretical pI 8.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 356-376
  • 421-441
  • 500-520
  • 551-571
  • 589-609
  • 715-735
  • 764-784
  • 844-864
Protein Sequence
>Anoctamin-7
MRMAATAWAGLQGPPLPTLCPAVRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRA
QEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQAAACRAGSPAKPRIADFVLVWEEDL
KLDRQQDSAARDRTDMHRTWRETFLDNLRAAGLCVDQQDVQDGNTTVHYALLSASWAVLC
YYAEDLRLKLPLQELPNQASNWSAGLLAWLGIPNVLLEVVPDVPPEYYSCRFRVNKLPRF
LGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKNLLGIHQLLAEGVLSAAFPLHDGPFKT
PPEGPQAPRLNQRQVLFQHWARWGKWNKYQPLDHVRRYFGEKVALYFAWLGFYTGWLLPA
AVVGTLVFLVGCFLVFSDIPTQELCGSKDSFEMCPLCLDCPFWLLSSACALAQAGRLFDH
GGTVFFSLFMALWAVLLLEYWKRKSATLAYRWDCSDYEDTEERPRPQFAASAPMTAPNPI
TGEDEPYFPERSRARRMLAGSVVIVVMVAVVVMCLVSIILYRAIMAIVVSRSGNTLLAAW
ASRIASLTGSVVNLVFILILSKIYVSLAHVLTRWEMHRTQTKFEDAFTLKVFIFQFVNFY
SSPVYIAFFKGRFVGYPGNYHTLFGVRNEECAAGGCLIELAQELLVIMVGKQVINNMQEV
LIPKLKGWWQKFRLRSKKRKAGASAGASQGPWEDDYELVPCEGLFDEYLEMVLQFGFVTI
FVAACPLAPLFALLNNWVEIRLDARKFVCEYRRPVAERAQDIGIWFHILAGLTHLAVISN
AFLLAFSSDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYS
QTYWNLLAIRLAFVIVFEHVVFSVGRLLDLLVPDIPESVEIKVKREYYLAKQALAENEVL
FGTNGTKDEQPKGSELSSHWTPFTVPKASQLQQ
GenBank ID Protein 48093524
UniProtKB/Swiss-Prot ID Q6IWH7
UniProtKB/Swiss-Prot Entry Name ANO7_HUMAN
PDB IDs Not Available
GenBank Gene ID AY617079
GeneCard ID ANO7
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]
  2. Bera TK, Das S, Maeda H, Beers R, Wolfgang CD, Kumar V, Hahn Y, Lee B, Pastan I: NGEP, a gene encoding a membrane protein detected only in prostate cancer and normal prostate. Proc Natl Acad Sci U S A. 2004 Mar 2;101(9):3059-64. Epub 2004 Feb 23. [PubMed:14981236 ]
  3. Walker MG, Volkmuth W, Sprinzak E, Hodgson D, Klingler T: Prediction of gene function by genome-scale expression analysis: prostate cancer-associated genes. Genome Res. 1999 Dec;9(12):1198-203. [PubMed:10613842 ]
  4. Katoh M, Katoh M: Characterization of human TMEM16G gene in silico. Int J Mol Med. 2004 Oct;14(4):759-64. [PubMed:15375614 ]
  5. Kiessling A, Weigle B, Fuessel S, Ebner R, Meye A, Rieger MA, Schmitz M, Temme A, Bachmann M, Wirth MP, Rieber EP: D-TMPP: a novel androgen-regulated gene preferentially expressed in prostate and prostate cancer that is the first characterized member of an eukaryotic gene family. Prostate. 2005 Sep 1;64(4):387-400. [PubMed:15761874 ]
  6. Das S, Hahn Y, Nagata S, Willingham MC, Bera TK, Lee B, Pastan I: NGEP, a prostate-specific plasma membrane protein that promotes the association of LNCaP cells. Cancer Res. 2007 Feb 15;67(4):1594-601. [PubMed:17308099 ]