You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07446
Secondary Accession Numbers
  • 13154
Name Anoctamin-8
Synonyms
  1. Transmembrane protein 16H
Gene Name ANO8
Protein Type Unknown
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function May act as a calcium-activated chloride channel
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.11
SNPs ANO8
Gene Sequence
>3699 bp
ATGGCCGAGGCCGCCTCCGGCGCCGGGGGCACGTCCCTGGAGGGCGAGCGTGGCAAGAGG
CCCCCGCCGGAGGGCGAGCCTGCAGCCCCGGCGTCCGGAGTTCTGGATAAGCTTTTCGGA
AAGCGGCTCCTGCAGGCTGGTCGCTACCTGGTGTCCCACAAGGCGTGGATGAAGACGGTG
CCTACAGAGAACTGCGACGTGCTGATGACCTTCCCAGACACGACCGATGACCACACGCTG
CTATGGCTGCTGAACCACATCCGCGTGGGCATTCCCGAGCTCATCGTGCAAGTCCGCCAC
CACCGCCACACGCGTGCCTACGCCTTCTTTGTCACCGCCACGTATGAGAGCCTACTCCGA
GGGGCCGACGAGCTGGGTCTGCGCAAAGCAGTGAAGGCCGAGTTTGGCGGGGGCACCCGC
GGCTTCTCCTGCGAGGAGGACTTTATCTATGAGAATGTGGAGAGCGAGCTACGCTTCTTC
ACCTCCCAGGAACGCCAGAGCATCATCCGCTTCTGGCTGCAGAATTTGCGTGCCAAGCAG
GGAGAAGCACTCCACAACGTGCGCTTCCTGGAGGACCAGCCAATCATCCCGGAGCTGGCA
GCACGTGGGATCATCCAGCAGGTGTTCCCTGTCCACGAGCAGCGTATTCTGAACCGCCTC
ATGAAGTCATGGGTGCAGGCCGTGTGTGAAAACCAGCCTCTAGATGACATCTGTGATTAC
TTTGGTGTGAAAATTGCCATGTACTTCGCCTGGCTGGGCTTCTACACGTCGGCTATGGTA
TACCCAGCTGTCTTCGGGTCTGTCCTGTACACATTCACAGAGGCTGATCAGACAAGCCGG
GATGTTTCCTGCGTGGTCTTTGCCCTCTTCAACGTGATCTGGTCGACGCTGTTCCTAGAG
GAATGGAAGCGGAGAGGGGCTGAGCTGGCATATAAGTGGGGGACGCTGGACTCACCTGGG
GAAGCCGTGGAGGAGCCACGCCCCCAGTTCAGGGGCGTGCGACGTATCAGCCCCATCACG
CGGGCCGAGGAGTTCTACTACCCGCCCTGGAAGCGGCTGCTCTTCCAGCTGCTTGTGAGC
CTCCCCCTGTGCCTGGCGTGCCTCGTCTGTGTCTTCTTGCTCATGCTTGGCTGCTTCCAG
CTGCAGGAGCTGGTGCTGAGCGTGAAGGGGTTGCCCCGTCTCGCCCGATTCCTGCCTAAG
GTCATGCTGGCCCTGCTTGTCAGTGTGAGTGCCGAGGGCTACAAGAAGCTAGCCATCTGG
CTCAATGACATGGAAAATTACCGGCTGGAGAGCGCCTATGAGAAGCACCTCATCATCAAA
GTTGTCCTGTTCCAGTTTGTCAACTCGTACCTGAGCCTCTTCTACATCGGTTTCTACCTC
AAGGACATGGAGCGCTTGAAAGAGATGCTGGCCACGCTGCTGATCACCCGCCAGTTCCTC
CAGAACGTGCGCGAGGTCCTGCAGCCGCACCTGTACCGGCGCCTGGGCCGCGGCGAGCTG
GGCCTGCGGGCCGTCTGGGAGCTGGCCCGAGCCCTGCTTGGCCTCCTGAGCCTCCGGCGC
CCTGCGCCCCGCCGCCTCGAACCCCAGGCGGATGAGGGCGGGGGCGGCGGCAGCGGGGGC
GGGGGCCGCAGGTGCCTCAGCGGGGGCTGCGGGGCGCCGGAGGAGGAGGAGGAGGCGGCG
CTGGTGGAGCGGCGGCGGGCGGGGGAAGGCGGGGAGGAGGGGGACGGGCCTCCAGGGGGC
AAGGAGGAGGACGAGGACGACGAGGAGGAGGAGGACGAGGAGGAAGAGGAGGACGAGGAG
GAGGGCGAGGAAGGGGGCCTCCTGGACTGCGGGCTCCGGCTGAAGAAGGTCAGCTTCGCT
GAGCGCGGCGCGGGGCGGCGTCGGCCCGGCCCAAGCCCGGAGGCCCTCCTGGAGGAAGGG
AGCCCCACTATGGTGGAGAAGGGGCTGGAGCCGGGAGTGTTCACCCTGGCCGAGGAGGAC
GACGAGGCGGAGGGGGCTCCCGGCAGCCCTGAACGGGAGCCCCCGGCCATCTTGTTCCGC
CGGGCCGGGGGCGAGGGCCGAGACCAGGGGCCCGACGGGGGCCCGGACCCGGAACCCGGC
TCCAACAGCGATTCGACCCGTAGGCAGAGACGGCAGAACCGGTCGTCTTGGATTGACCCG
CCGGAGGAGGAACACTCGCCCCAGCTCACCCAGGCAGAGCTGGAGAGCTGTATGAAGAAG
TACGAGGACACGTTCCAGGACTACCAGGAGATGTTCGTGCAGTTCGGCTACGTTGTGCTC
TTCTCGTCCGCCTTCCCCCTGGCGGCGCTGTGCGCCCTGGTCAACAACCTCATTGAGATC
CGCAGCGACGCCTTCAAGCTGTGCACCGGGCTGCAGCGGCCCTTCGGCCAGCGCGTGGAA
AGCATCGGCCAGTGGCAGAAGGTGATGGAGGCCATGGGTGTCCTAGCGATTGTGGTCAAC
TGCTACTTAATCGGCCAGTGCGGGCAGCTGCAGCGCCTCTTCCCCTGGCTGAGCCCGGAG
GCAGCCATCGTGTCGGTGGTAGTGCTCGAGCACTTCGCTCTGCTCCTCAAGTACCTCATC
CACGTGGCCATCCCCGATATCCCGGGCTGGGTGGCCGAGGAAATGGCCAAGCTGGAGTAC
CAGCGCCGCGAGGCCTTTAAGAGACACGAGCGCCAGGCCCAGCATCGCTACCAGCAGCAG
CAGCGCAGGCGGCGGGAGGAGGAGGAGCGACAGCGCCATGCAGAGCACCATGCCCGGCGG
GAGCATGATTCTGGTGGCCGAGAGGAGGCGAGGGCCGAGGGCTCTGGGCTGGACCCTGCC
ACCTCCTCCGAGAAGGCCTCTGCCAAGGCCAAGGGCAGCACTGCGGGTGGCCACGGGCCT
GAACGGCCCAAGCGCCCAGGGTCCCTGCTGGCACCCAACAACGTCATGAAGTTGAAGCAG
ATCATCCCACTGCAGGGCAAATTCCTCTCGTCAGGGGCCACATCCTCACTGGCTGCTGCA
GGGGCCGGAGCCACCACCCGGCCTCCCCCTGCCCAGTCACCCACAGGCAGCGACACCCGC
CTGCCTGCCTTCCTCAGCTTCAAGTTCCTCAAGTCACCCGAGACCCGGCGGGACTCTGAG
CGCAGCCACTCACCGCCCAAAGCCTTCCATGCTGGCAAGCTCTTCCCCTTTGGTGGCACC
CGGGCTGAGCCTGGGTCCAACGGGGCGGGCGGGCAGGCCCGGCCAGATGGGACCCCCAGC
AGTGGCAGCAGCCGGGTTCAGAGGAGTGGGCCGGTGGACGAGGCCCTGGCTGAGGAGCTG
GAAGCCCCCCGGCCCGAAGAGGAAGGCTCAGGGACAGCGCTGGCCCCCGTGGGCGCCCCT
GCCCTCCGCACCCGCCGCAGCCGGAGCCCCGCGCCGCCGCCGCCAATGCCGCTGCCCCGG
CCCCCGACACCGCCCGCAGGCTGCTGGCAGTGGGACGGGCCCTGGGGCTGCGGGGGCGAG
GGTGCCGCCCCCCGCCAGGCCCTGGCCGCTGCCGAGTGCCCACCCTGTGCCATGGCCGGG
CCCCCACCCGCCCCCCAGCCCCTGCCGGGAGACGCCAGCTTTTACAGCCTCCCGCCCCCA
CCGCTACCGCCCACCTCGGATCCCCTCGAGACCCCAGCGCCCTCCCCTAGCCCCAGCCCC
AGCCCCCAGGCCGTGTGCTGGCCCAGCGGCTGGCATTAG
Protein Properties
Number of Residues 1232
Molecular Weight 136033.0
Theoretical pI 5.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 245-265
  • 282-302
  • 357-377
  • 401-421
  • 438-458
  • 751-771
  • 808-828
  • 842-862
Protein Sequence
>Anoctamin-8
MAEAASGAGGTSLEGERGKRPPPEGEPAAPASGVLDKLFGKRLLQAGRYLVSHKAWMKTV
PTENCDVLMTFPDTTDDHTLLWLLNHIRVGIPELIVQVRHHRHTRAYAFFVTATYESLLR
GADELGLRKAVKAEFGGGTRGFSCEEDFIYENVESELRFFTSQERQSIIRFWLQNLRAKQ
GEALHNVRFLEDQPIIPELAARGIIQQVFPVHEQRILNRLMKSWVQAVCENQPLDDICDY
FGVKIAMYFAWLGFYTSAMVYPAVFGSVLYTFTEADQTSRDVSCVVFALFNVIWSTLFLE
EWKRRGAELAYKWGTLDSPGEAVEEPRPQFRGVRRISPITRAEEFYYPPWKRLLFQLLVS
LPLCLACLVCVFLLMLGCFQLQELVLSVKGLPRLARFLPKVMLALLVSVSAEGYKKLAIW
LNDMENYRLESAYEKHLIIKVVLFQFVNSYLSLFYIGFYLKDMERLKEMLATLLITRQFL
QNVREVLQPHLYRRLGRGELGLRAVWELARALLGLLSLRRPAPRRLEPQADEGGGGGSGG
GGRRCLSGGCGAPEEEEEAALVERRRAGEGGEEGDGPPGGKEEDEDDEEEEDEEEEEDEE
EGEEGGLLDCGLRLKKVSFAERGAGRRRPGPSPEALLEEGSPTMVEKGLEPGVFTLAEED
DEAEGAPGSPEREPPAILFRRAGGEGRDQGPDGGPDPEPGSNSDSTRRQRRQNRSSWIDP
PEEEHSPQLTQAELESCMKKYEDTFQDYQEMFVQFGYVVLFSSAFPLAALCALVNNLIEI
RSDAFKLCTGLQRPFGQRVESIGQWQKVMEAMGVLAIVVNCYLIGQCGQLQRLFPWLSPE
AAIVSVVVLEHFALLLKYLIHVAIPDIPGWVAEEMAKLEYQRREAFKRHERQAQHRYQQQ
QRRRREEEERQRHAEHHARREHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGP
ERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGATSSLAAAGAGATTRPPPAQSPTGSDTR
LPAFLSFKFLKSPETRRDSERSHSPPKAFHAGKLFPFGGTRAEPGSNGAGGQARPDGTPS
SGSSRVQRSGPVDEALAEELEAPRPEEEGSGTALAPVGAPALRTRRSRSPAPPPPMPLPR
PPTPPAGCWQWDGPWGCGGEGAAPRQALAAAECPPCAMAGPPPAPQPLPGDASFYSLPPP
PLPPTSDPLETPAPSPSPSPSPQAVCWPSGWH
GenBank ID Protein 55741655
UniProtKB/Swiss-Prot ID Q9HCE9
UniProtKB/Swiss-Prot Entry Name ANO8_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020959.2
GeneCard ID ANO8
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Nagase T, Kikuno R, Nakayama M, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Aug 31;7(4):273-81. [PubMed:10997877 ]
  4. Yang YD, Cho H, Koo JY, Tak MH, Cho Y, Shim WS, Park SP, Lee J, Lee B, Kim BM, Raouf R, Shin YK, Oh U: TMEM16A confers receptor-activated calcium-dependent chloride conductance. Nature. 2008 Oct 30;455(7217):1210-5. doi: 10.1038/nature07313. Epub 2008 Aug 24. [PubMed:18724360 ]
  5. Katoh M, Katoh M: Identification and characterization of TMEM16H gene in silico. Int J Mol Med. 2005 Feb;15(2):353-8. [PubMed:15647853 ]