Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07449
Secondary Accession Numbers
  • 13157
Name Anthrax toxin receptor 2
Synonyms
  1. CMG-2
  2. Capillary morphogenesis gene 2 protein
Gene Name ANTXR2
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Necessary for cellular interactions with laminin and the extracellular matrix
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
molecular transducer activity
signal transducer activity
Cellular Location
  1. Isoform 3:Secreted
Gene Properties
Chromosome Location Chromosome:4
Locus 4q21.21
SNPs ANTXR2
Gene Sequence
>1470 bp
ATGGTGGCGGAGCGGTCCCCGGCCCGCAGCCCCGGGAGCTGGCTGTTCCCCGGGCTGTGG
CTGTTGGTGCTCAGCGGTCCCGGGGGGCTGCTGCGCGCCCAGGAGCAGCCCTCCTGCAGA
AGAGCCTTTGATCTCTACTTCGTCCTGGACAAGTCTGGGAGTGTGGCAAATAACTGGATT
GAAATTTATAATTTCGTACAGCAACTTGCGGAGAGATTTGTGAGCCCTGAAATGAGATTA
TCTTTCATTGTGTTTTCTTCTCAAGCAACTATTATTTTGCCATTAACTGGAGACAGAGGC
AAAATCAGTAAAGGCTTGGAGGATTTAAAACGTGTTAGTCCAGTAGGAGAGACATATATC
CATGAAGGACTAAAGCTAGCGAATGAACAAATTCAGAAAGCAGGAGGCTTGAAAACCTCC
AGTATCATAATTGCTCTGACAGATGGCAAGTTGGACGGTCTGGTGCCATCATATGCAGAG
AAAGAGGCAAAGATATCCAGGTCACTTGGGGCTAGTGTTTATTGTGTTGGTGTCCTTGAT
TTTGAACAAGCACAGCTTGAAAGAATTGCTGATTCCAAGGAGCAAGTTTTCCCTGTCAAA
GGTGGATTTCAGGCTCTTAAAGGAATAATTAATTCTATACTAGCTCAGTCATGTACTGAA
ATCCTAGAATTGCAGCCCTCAAGTGTCTGTGTGGGGGAGGAATTTCAGATTGTCTTAAGT
GGAAGAGGATTCATGCTGGGCAGTCGGAATGGCAGTGTTCTCTGCACTTACACTGTAAAT
GAAACATATACAACGAGTGTAAAACCAGTAAGTGTACAGCTTAATTCTATGCTTTGTCCT
GCACCTATCCTGAATAAAGCTGGAGAAACTCTTGATGTTTCAGTGAGCTTTAATGGAGGA
AAATCTGTCATTTCAGGATCATTAATTGTCACAGCCACAGAATGTTCTAACGGGATCGCA
GCCATCATTGTTATTTTGGTGTTACTGCTACTCCTGGGGATCGGTTTGATGTGGTGGTTT
TGGCCCCTTTGCTGCAAAGTGGTTATTAAGGATCCTCCACCACCACCCGCCCCTGCACCA
AAAGAGGAGGAAGAAGAACCTTTGCCTACTAAAAAGTGGCCAACTGTGGATGCTTCCTAT
TATGGTGGTCGAGGGGTTGGAGGAATTAAAAGAATGGAGGTTCGTTGGGGTGATAAAGGA
TCTACTGAGGAAGGTGCAAGGCTAGAGAAAGCCAAAAATGCTGTGGTGAAGATTCCTGAA
GAAACAGAGGAACCCATCAGGCCTAGACCACCTCGACCCAAACCCACACACCAGCCTCCT
CAGACAAAATGGTACACCCCAATTAAGGGTCGTCTTGATGCTCTCTGGGCTTTGTTGAGG
CGGCAGTATGACCGGGTTTCTTTGATGCGACCTCAGGAAGGAGATGAGGTTTGTATATGG
GAATGTATTGAGAAAGAGCTAACTGCTTGA
Protein Properties
Number of Residues 489
Molecular Weight 53665.7
Theoretical pI 7.53
Pfam Domain Function
Signals
  • 1-33
Transmembrane Regions
  • 319-341
Protein Sequence
>Anthrax toxin receptor 2
MVAERSPARSPGSWLFPGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWI
EIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYI
HEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLD
FEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLS
GRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGG
KSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIKDPPPPPAPAP
KEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVKIPE
ETEEPIRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEVCIW
ECIEKELTA
GenBank ID Protein 224809466
UniProtKB/Swiss-Prot ID P58335
UniProtKB/Swiss-Prot Entry Name ANTR2_HUMAN
PDB IDs
GenBank Gene ID NM_001145794.1
GeneCard ID ANTXR2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Scobie HM, Rainey GJ, Bradley KA, Young JA: Human capillary morphogenesis protein 2 functions as an anthrax toxin receptor. Proc Natl Acad Sci U S A. 2003 Apr 29;100(9):5170-4. Epub 2003 Apr 16. [PubMed:12700348 ]
  7. Bell SE, Mavila A, Salazar R, Bayless KJ, Kanagala S, Maxwell SA, Davis GE: Differential gene expression during capillary morphogenesis in 3D collagen matrices: regulated expression of genes involved in basement membrane matrix assembly, cell cycle progression, cellular differentiation and G-protein signaling. J Cell Sci. 2001 Aug;114(Pt 15):2755-73. [PubMed:11683410 ]
  8. Abrami L, Liu S, Cosson P, Leppla SH, van der Goot FG: Anthrax toxin triggers endocytosis of its receptor via a lipid raft-mediated clathrin-dependent process. J Cell Biol. 2003 Feb 3;160(3):321-8. Epub 2003 Jan 27. [PubMed:12551953 ]
  9. Abrami L, Lindsay M, Parton RG, Leppla SH, van der Goot FG: Membrane insertion of anthrax protective antigen and cytoplasmic delivery of lethal factor occur at different stages of the endocytic pathway. J Cell Biol. 2004 Aug 30;166(5):645-51. [PubMed:15337774 ]
  10. Santelli E, Bankston LA, Leppla SH, Liddington RC: Crystal structure of a complex between anthrax toxin and its host cell receptor. Nature. 2004 Aug 19;430(7002):905-8. Epub 2004 Jul 4. [PubMed:15243628 ]
  11. Lacy DB, Wigelsworth DJ, Scobie HM, Young JA, Collier RJ: Crystal structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor. Proc Natl Acad Sci U S A. 2004 Apr 27;101(17):6367-72. Epub 2004 Apr 12. [PubMed:15079089 ]
  12. Lacy DB, Wigelsworth DJ, Melnyk RA, Harrison SC, Collier RJ: Structure of heptameric protective antigen bound to an anthrax toxin receptor: a role for receptor in pH-dependent pore formation. Proc Natl Acad Sci U S A. 2004 Sep 7;101(36):13147-51. Epub 2004 Aug 23. [PubMed:15326297 ]
  13. Hanks S, Adams S, Douglas J, Arbour L, Atherton DJ, Balci S, Bode H, Campbell ME, Feingold M, Keser G, Kleijer W, Mancini G, McGrath JA, Muntoni F, Nanda A, Teare MD, Warman M, Pope FM, Superti-Furga A, Futreal PA, Rahman N: Mutations in the gene encoding capillary morphogenesis protein 2 cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Am J Hum Genet. 2003 Oct;73(4):791-800. Epub 2003 Aug 21. [PubMed:14508707 ]
  14. Dowling O, Difeo A, Ramirez MC, Tukel T, Narla G, Bonafe L, Kayserili H, Yuksel-Apak M, Paller AS, Norton K, Teebi AS, Grum-Tokars V, Martin GS, Davis GE, Glucksman MJ, Martignetti JA: Mutations in capillary morphogenesis gene-2 result in the allelic disorders juvenile hyaline fibromatosis and infantile systemic hyalinosis. Am J Hum Genet. 2003 Oct;73(4):957-66. Epub 2003 Sep 12. [PubMed:12973667 ]
  15. Lee JY, Tsai YM, Chao SC, Tu YF: Capillary morphogenesis gene-2 mutation in infantile systemic hyalinosis: ultrastructural study and mutation analysis in a Taiwanese infant. Clin Exp Dermatol. 2005 Mar;30(2):176-9. [PubMed:15725249 ]