You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07457
Secondary Accession Numbers
  • 13165
Name Arylsulfatase F
Synonyms
  1. ASF
Gene Name ARSF
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
sulfuric ester hydrolase activity
Process
metabolic process
Cellular Location
  1. Secreted (Potential)
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs ARSF
Gene Sequence
>1773 bp
ATGAGGCCCAGGAGACCCTTGGTCTTCATGTCTTTGGTGTGTGCACTCTTGAACACATGC
CAGGCACACAGGGTGCATGACGACAAGCCTAATATTGTCCTAATCATGGTTGATGACCTG
GGTATTGGAGATCTGGGCTGCTACGGCAATGACACCATGAGGACGCCTCACATCGACCGC
CTTGCCAGGGAAGGCGTGCGACTGACTCAGCACATCTCTGCCGCCTCCCTCTGCAGCCCA
AGCCGGTCCGCGTTCTTGACGGGAAGATACCCCATCCGATCAGGTATGGTTTCTAGTGGT
AATAGACGTGTCATCCAAAATCTTGCAGTCCCCGCAGGCCTCCCTCTTAATGAGACAACA
CTTGCAGCCTTGCTAAAGAAGCAAGGATACAGCACGGGGCTTATAGGCAAATGGCACCAA
GGCTTGAACTGCGACTCCCGAAGTGACCAGTGCCACCATCCATATAATTATGGGTTTGAC
TACTACTATGGCATGCCGTTCACTCTCGTTGACAGCTGCTGGCCGGACCCCTCTCGTAAC
ACGGAATTAGCCTTTGAGAGTCAGCTCTGGCTCTGTGTGCAGCTAGTTGCCATTGCCATC
CTCACCCTAACCTTTGGGAAGCTGAGCGGCTGGGTCTCTGTTCCCTGGCTCCTGATCTTC
TCCATGATTCTGTTTATTTTCCTCTTGGGCTATGCTTGGTTCTCCAGCCACACGTCCCCT
TTATACTGGGACTGCCTCCTCATGCGGGGGCACGAGATCACGGAGCAGCCCATGAAGGCT
GAACGAGCTGGATCCATTATGGTGAAGGAAGCGATTTCCTTTTTAGAAAGGCACAGTAAG
GAAACTTTCCTTCTCTTTTTCTCCTTTCTTCACGTGCACACACCTCTCCCCACCACGGAC
GATTTCACTGGCACCAGCAAGCATGGCTTGTATGGGGATAATGTGGAAGAGATGGACTCC
ATGGTGGGCAAGATTCTTGATGCTATCGATGATTTTGGCCTAAGGAACAACACCCTTGTC
TACTTTACATCAGATCACGGAGGGCATTTGGAAGCTAGGCGAGGGCATGCCCAACTTGGT
GGATGGAATGGAATATACAAAGGTGGAAAAGGCATGGGGGGCTGGGAAGGTGGAATCCGC
GTCCCAGGAATTGTCCGATGGCCTGGAAAGGTACCAGCTGGACGGTTGATTAAGGAACCT
ACAAGTTTAATGGATATTTTACCAACTGTCGCATCAGTGTCAGGAGGAAGTCTCCCTCAG
GACAGGGTCATTGACGGCCGAGACCTCATGCCCTTGCTGCAGGGCAACGTCAGGCACTCG
GAGCATGAATTTCTTTTCCACTACTGTGGCTCCTACCTGCACGCCGTGCGGTGGATCCCC
AAGGACGACAGTGGGTCAGTTTGGAAGGCTCACTATGTGACCCCGGTATTCCAGCCACCA
GCTTCTGGTGGCTGCTATGTCACCTCATTATGCAGATGTTTCGGAGAACAGGTTACCTAC
CACAACCCCCCTCTGCTCTTCGATCTCTCCAGGGACCCCTCAGAGTCCACACCCCTGACA
CCTGCCACAGAGCCCCTCCATGATTTTGTGATTAAAAAGGTGGCCAACGCCCTGAAGGAA
CACCAGGAAACCATCGTGCCTGTGACCTACCAACTCTCAGAACTGAATCAGGGCAGGACG
TGGCTGAAGCCTTGCTGTGGGGTGTTCCCATTTTGTCTGTGTGACAAGGAAGAGGAAGTC
TCTCAGCCTCGGGGTCCTAACGAGAAGAGATAA
Protein Properties
Number of Residues 590
Molecular Weight 65939.1
Theoretical pI 7.22
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Arylsulfatase F
MRPRRPLVFMSLVCALLNTCQAHRVHDDKPNIVLIMVDDLGIGDLGCYGNDTMRTPHIDR
LAREGVRLTQHISAASLCSPSRSAFLTGRYPIRSGMVSSGNRRVIQNLAVPAGLPLNETT
LAALLKKQGYSTGLIGKWHQGLNCDSRSDQCHHPYNYGFDYYYGMPFTLVDSCWPDPSRN
TELAFESQLWLCVQLVAIAILTLTFGKLSGWVSVPWLLIFSMILFIFLLGYAWFSSHTSP
LYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFLERHSKETFLLFFSFLHVHTPLPTTD
DFTGTSKHGLYGDNVEEMDSMVGKILDAIDDFGLRNNTLVYFTSDHGGHLEARRGHAQLG
GWNGIYKGGKGMGGWEGGIRVPGIVRWPGKVPAGRLIKEPTSLMDILPTVASVSGGSLPQ
DRVIDGRDLMPLLQGNVRHSEHEFLFHYCGSYLHAVRWIPKDDSGSVWKAHYVTPVFQPP
ASGGCYVTSLCRCFGEQVTYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALKE
HQETIVPVTYQLSELNQGRTWLKPCCGVFPFCLCDKEEEVSQPRGPNEKR
GenBank ID Protein 31742482
UniProtKB/Swiss-Prot ID P54793
UniProtKB/Swiss-Prot Entry Name ARSF_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004042.3
GeneCard ID ARSF
GenAtlas ID ARSF
HGNC ID HGNC:721
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Franco B, Meroni G, Parenti G, Levilliers J, Bernard L, Gebbia M, Cox L, Maroteaux P, Sheffield L, Rappold GA, Andria G, Petit C, Ballabio A: A cluster of sulfatase genes on Xp22.3: mutations in chondrodysplasia punctata (CDPX) and implications for warfarin embryopathy. Cell. 1995 Apr 7;81(1):15-25. [PubMed:7720070 ]
  4. Puca AA, Zollo M, Repetto M, Andolfi G, Guffanti A, Simon G, Ballabio A, Franco B: Identification by shotgun sequencing, genomic organization, and functional analysis of a fourth arylsulfatase gene (ARSF) from the Xp22.3 region. Genomics. 1997 Jun 1;42(2):192-9. [PubMed:9192838 ]